WH0003081M10

Monoclonal Anti-HGD antibody produced in mouse

clone 3G4, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): Anti-AKU, Anti-HGO, Anti-homogentisate 1,2-dioxygenase (homogentisate oxidase)
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 3G4, monoclonal
• forma: buffered aqueous solution
• reatividade de espécies: human
• técnica(s): immunofluorescence: suitable; indirect ELISA: suitable
• Isotipo: IgG2bκ
• nº de adesão GenBank: NM_000187
• nº de adesão UniProt: Q93099
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... HGD(3081)

Descrição

Descrição geral

Homogentisate 1,2-dioxygenase (HGD) gene mutations are the molecular cause of alkaptonuria, a rare hereditary disorder of the phenylalanine catabolism. The highest expression of HGD is in the prostate, small intestine, colon, and liver. The HGD gene contains 14 exons. Conflicting reports have placed the gene at 3q2, 3q13.3-q21, 3q21-q24, 3q21-q23, or 3q25-q26. (provided by RefSeq)

Imunogênio

HGD (NP_000178, 377 a.a. ~ 445 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
CFEKASKVKLAPERIADGTMAFMFESSLSLAVTKWGLKASRCLDENYHKCWEPLKSHFTPNSRNPAEPN

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)