Pular para o conteúdo
Merck
Todas as fotos(5)

Documentos Principais

WH0002810M1

Sigma-Aldrich

Monoclonal Anti-SFN antibody produced in mouse

clone 3C3, purified immunoglobulin, buffered aqueous solution

Sinônimo(s):

Anti-stratifin

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(5)

About This Item

Número MDL:
MFCD02685677
Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

mouse

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

purified immunoglobulin

tipo de produto de anticorpo

primary antibodies

clone

3C3, monoclonal

forma

buffered aqueous solution

reatividade de espécies

human

técnica(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
immunoprecipitation (IP): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotipo

IgG1κ

nº de adesão GenBank

BC000329

nº de adesão UniProt

P31947

Condições de expedição

dry ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... SFN(2810)

Categorias relacionadas

Descrição geral

Stratifin (SFN), a cell cycle checkpoint protein, is expressed at low levels on the nervous and reproductive systems, like the cortex, retina, placenta, and ovary.

Imunogênio

SFN (AAH00329.1, 1 a.a. ~ 248 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKAETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS

Aplicação

Monoclonal Anti-SFN antibody produced in mouse has been used in immunohistochemistry (1:200).

Ações bioquímicas/fisiológicas

Stratifin (SFN) plays a key role in oncogenesis. It regulates mitotic translation. SFN frequently inhibits DNA errors during mitosis as a reaction to DNA damage. It acts as a potential biomarker in various cancers.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Equipamento de proteção individual

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Marie M J Lecomte et al.
Skin research and technology : official journal of International Society for Bioengineering and the Skin (ISBS) [and] International Society for Digital Imaging of Skin (ISDIS) [and] International Society for Skin Imaging (ISSI), 19(1), 27-34 (2012-06-16)
The use of biomarkers in skin is a novel diagnostic tool. Interstitial fluid (ISF) from skin provides a snapshot of proteins secreted at the time of sampling giving insights into the patient's health status. A minimally invasive technique for the
Yi Hu et al.
Bioscience reports, 39(5) (2019-03-31)
Ovarian cancer is a highly lethal cancer in females. Therefore, it is necessary to explore effective biomarkers for the diagnosis and prognosis of the disease. Stratifin (SFN) is a cell cycle checkpoint protein that has been reported to be involved
Paulina Kober et al.
Molecular and cellular endocrinology, 473, 194-204 (2018-02-08)
Nonfunctioning pituitary adenomas (NFPAs) are among the most frequent intracranial tumors but their molecular background, including changes in epigenetic regulation, remains poorly understood. We performed genome-wide DNA methylation profiling of 34 NFPAs and normal pituitary samples. Methylation status of the

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica