WH0002669M1

Monoclonal Anti-GEM antibody produced in mouse

clone 4B12, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): Anti-GTP binding protein overexpressed in skeletal muscle, Anti-KIR, Anti-MGC26294
• Número MDL: MFCD01633463
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 4B12, monoclonal
• Formulário: buffered aqueous solution
• reatividade de espécies: human
• técnica(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• nº de adesão GenBank: BC022010
• nº de adesão UniProt: P55040
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... GEM(2669)

Descrição

Descrição geral

The protein encoded by this gene belongs to the RAD/GEM family of GTP-binding proteins. It is associated with the inner face of the plasma membrane and could play a role as a regulatory protein in receptor-mediated signal transduction. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified. (provided by RefSeq)

Imunogênio

GEM (AAH22010, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MTLNNVTMRQGTVGMQPQQQRWSIPADGRHLMVQKEPHQYSHRNRHSATPEDHCRRSWSSDSTDSVISSESGNTYYRVVLIGEQGVGKSTLANIFAGVHD

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)