Pular para o conteúdo
Merck
Todas as fotos(1)

Documentos Principais

SRP0164

Sigma-Aldrich

Histone H4 (2-58) human

recombinant, expressed in E. coli, ≥70% (SDS-PAGE)

Sinônimo(s):

HIST2H4A

Faça loginpara ver os preços organizacionais e de contrato

Selecione um tamanho

500 μG
R$ 1.712,00

R$ 1.712,00


Check Cart for Availability

Solicite uma grande encomenda

Selecione um tamanho

Alterar visualização
500 μG
R$ 1.712,00

About This Item

Código UNSPSC:
12352200
NACRES:
NA.77

R$ 1.712,00


Check Cart for Availability

Solicite uma grande encomenda

fonte biológica

human

recombinante

expressed in E. coli

Ensaio

≥70% (SDS-PAGE)

Formulário

aqueous solution

peso molecular

32 kDa

embalagem

pkg of 500 μg

condição de armazenamento

avoid repeated freeze/thaw cycles

nº de adesão NCBI

nº de adesão UniProt

Condições de expedição

dry ice

temperatura de armazenamento

−70°C

Informações sobre genes

human ... HIST2H4A(8370)

Descrição geral

Human Histone 4 (GenBank Accession No. NM_003548), (2-58) with N-terminal GST-tag, MW = 32 kDa, expressed in an E. coli expression system.

forma física

Formulated in 25 mM Tris-HCl, pH 8.0, 100 mM NaCl, 0.05% Tween-20, 20% glycerol and 3 mM DTT.

Nota de preparo

Thaw on ice. Upon first thaw, briefly spin tube containing enzyme to recover full content of the tube. Aliquot enzyme into single use aliquots. Store remaining undiluted enzyme in aliquots at -70°C. Note: Enzyme is very sensitive to freeze/thaw cycles.

Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Questions

1–2 of 2 Questions  
  1. What is the amino acid sequence of Histone H4 (2-58) human, Product SRP0164?

    1 answer
    1. The sequence for Product SRP0164, Histone H4 (2-58) human is as follows:SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGV

      Helpful?

  2. What is the Department of Transportation shipping information for this product?

    1 answer
    1. Transportation information can be found in Section 14 of the product's (M)SDS.To access the shipping information for this material, use the link on the product detail page for the product.

      Helpful?

Reviews

No rating value

Active Filters

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica