The sequence for Product SRP0164, Histone H4 (2-58) human is as follows:SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGV
SRP0164
Histone H4 (2-58) human
recombinant, expressed in E. coli, ≥70% (SDS-PAGE)
Sinônimo(s):
HIST2H4A
Faça loginpara ver os preços organizacionais e de contrato
Selecione um tamanho
500 μG
R$ 1.712,00
Selecione um tamanho
Alterar visualização
500 μG
R$ 1.712,00
About This Item
Código UNSPSC:
12352200
NACRES:
NA.77
Produtos recomendados
fonte biológica
human
recombinante
expressed in E. coli
Ensaio
≥70% (SDS-PAGE)
Formulário
aqueous solution
peso molecular
32 kDa
embalagem
pkg of 500 μg
condição de armazenamento
avoid repeated freeze/thaw cycles
nº de adesão NCBI
nº de adesão UniProt
Condições de expedição
dry ice
temperatura de armazenamento
−70°C
Informações sobre genes
human ... HIST2H4A(8370)
Descrição geral
Human Histone 4 (GenBank Accession No. NM_003548), (2-58) with N-terminal GST-tag, MW = 32 kDa, expressed in an E. coli expression system.
forma física
Formulated in 25 mM Tris-HCl, pH 8.0, 100 mM NaCl, 0.05% Tween-20, 20% glycerol and 3 mM DTT.
Nota de preparo
Thaw on ice. Upon first thaw, briefly spin tube containing enzyme to recover full content of the tube. Aliquot enzyme into single use aliquots. Store remaining undiluted enzyme in aliquots at -70°C. Note: Enzyme is very sensitive to freeze/thaw cycles.
Escolha uma das versões mais recentes:
Certificados de análise (COA)
Lot/Batch Number
Não está vendo a versão correta?
Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.
Já possui este produto?
Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.
-
What is the amino acid sequence of Histone H4 (2-58) human, Product SRP0164?
1 answer-
Helpful?
-
-
What is the Department of Transportation shipping information for this product?
1 answer-
Transportation information can be found in Section 14 of the product's (M)SDS.To access the shipping information for this material, use the link on the product detail page for the product.
Helpful?
-
Active Filters
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
Entre em contato com a assistência técnica
