SAB5702319

Anti-CD35/CR1 Antibody, clone 2A0Q1, Rabbit Monoclonal

• Sinônimo(s): C3BR, C4BR, CD35, KN
• Código UNSPSC: 12352203
• NACRES: NA.46

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• Materiais: colorless
• clone: 2A0Q1, monoclonal
• forma: liquid
• reatividade de espécies: human, rat, rat
• concentração: 1.10 mg/mL
• técnica(s): immunofluorescence: 1:50 - 1:200; immunohistochemistry: 1:50 - 1:200
• cor: colorless
• Isotipo: IgG
• sequência de imunogênio: DGYTLEGSPWSQCQADDRWDPPLAKCTSRTHDALIVGTLSGTIFFILLIIFLSWIILKHRKGNNAHENPKEVAIHLHSQGGSSVHPRTLQTNEENSRVLP
• nº de adesão UniProt: P17927
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... CR1(1378)

Descrição

Descrição geral

This gene is a member of the receptors of complement activation (RCA) family and is located in the 'cluster RCA' region of chromosome 1. The gene encodes a monomeric single-pass type I membrane glycoprotein found on erythrocytes, leukocytes, glomerular podocytes, and splenic follicular dendritic cells. The Knops blood group system is a system of antigens located on this protein. The protein mediates cellular binding to particles and immune complexes that have activated complement. Decreases in expression of this protein and/or mutations in its gene have been associated with gallbladder carcinomas, mesangiocapillary glomerulonephritis, systemic lupus erythematosus and sarcoidosis. Mutations in this gene have also been associated with a reduction in Plasmodium falciparum rosetting, conferring protection against severe malaria. Alternate allele-specific splice variants, encoding different isoforms, have been characterized. Additional allele specific isoforms, including a secreted form, have been described but have not been fully characterized. [provided by RefSeq, Jul 2008]

Imunogênio

A synthetic peptide corresponding to a sequence within amino acids 1940-2039 of human CD35/CR1 (P17927).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Aplicação

IHC, IF/ICC

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1