SAB2108805

Anti-GH1 (C-terminal) antibody produced in rabbit HRP conjugate

affinity isolated antibody

• Sinônimo(s): TSG-6, TSG6
• Código UNSPSC: 12352203
• NACRES: NA.45

Propriedades

• fonte biológica: rabbit
• conjugado: peroxidase conjugate
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• forma: buffered aqueous solution
• peso molecular: 20 kDa
• reatividade da espécie (prevista por homologia): rabbit, human, pig, bovine, rat, goat, mouse, horse
• concentração: 0.5 mg/mL
• nº de adesão NCBI: NM_022560
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... GH1(2688)

Descrição

Descrição geral

The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed in the pituitary but not in placental tissue as is the case for the other four genes in the growth hormone locus. Mutations in or deletions of the gene lead to growth hormone deficiency and short stature.

Sequência

Synthetic peptide located within the following region: TYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF

forma física

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 12 - Non Combustible Liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable