Free fatty acid receptor 1 (FFAR1) formerly known as G-protein coupled receptor 40 (GPR 40) is predominantly expressed in pancreatic beta cells. In human chromosome, the gene FFAR1 is located on 19q13.12.
Imunogênio
Synthetic peptide directed towards the N terminal region of human FFAR1
Ações bioquímicas/fisiológicas
Free fatty acid receptor 1 (FFAR1) is activated by binding of medium or long chain free fatty acids. It increases the Ca2+ level intracellularly through phospholipase C mediated signalling and that potentially stimulates insulin production. FFAR1 is a potential drug target for metabolic diseases like type 2 diabetes.
Sequência
Synthetic peptide located within the following region: KVSEAALSLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLV
forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Exoneração de responsabilidade
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Não está encontrando o produto certo?
Experimente o nosso Ferramenta de seleção de produtos.
Free fatty acids regulate insulin secretion from pancreatic beta cells through GPR40
Itoh Y, et al.
Nature, 422(6928), 173-176 (2003)
Free fatty acid receptors FFAR1 and GPR120 as novel therapeutic targets for metabolic disorders
Hara T, et al.
Journal of Pharmaceutical Sciences, 100(9), 3594-3601 (2011)
Re-evaluation of fatty acid receptor 1 (FFAR1/GPR40) as drug target for the stimulation of insulin secretion in humans
Wagner R, et al.
Diabetes, DB_121249-DB_121249 (2013)
Questions
Reviews
★★★★★ No rating value
Active Filters
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
