Tubulin, β 6 class V (TUBB6) is encoded by a multigene family.It is located on human chromosome 18p11.21.
Imunogênio
Synthetic peptide directed towards the N terminal region of human TUBB6
Ações bioquímicas/fisiológicas
Tubulin, β 6 class V (TUBB6) expression expression is correlated with microtubule stability. TUBB6 expression decreases in most tumors. Mutation in TUBB6 leads to velopharyngeal dysfunction, bilateral ptosis and congenital non-progressive facial palsy.Increased production of TUBB6 causes complete disruption of microtubule network and lowers pyroptosis.
Sequência
Synthetic peptide located within the following region: QLERINVYYNESSSQKYVPRAALVDLEPGTMDSVRSGPFGQLFRPDNFIF
forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Exoneração de responsabilidade
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Não está encontrando o produto certo?
Experimente o nosso Ferramenta de seleção de produtos.
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
