Pular para o conteúdo
Merck
Todas as fotos(2)

Documentos Principais

SAB2108239

Sigma-Aldrich

Anti-TNNT2 antibody produced in rabbit

affinity isolated antibody

Faça loginpara ver os preços organizacionais e de contrato

Selecione um tamanho

100 μL
R$ 3.042,00

R$ 3.042,00


Check Cart for Availability


Selecione um tamanho

Alterar visualização
100 μL
R$ 3.042,00

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

R$ 3.042,00


Check Cart for Availability

fonte biológica

rabbit

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

peso molecular

35kDa

reatividade de espécies

mouse, guinea pig, rat, horse, sheep, rabbit, bovine, dog, human

concentração

0.5 mg - 1 mg/mL

técnica(s)

immunoblotting: suitable

nº de adesão NCBI

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... TNNT2(7139)

Descrição geral

The previously assigned protein identifier A2TDB9 has been merged into P45379. Full details can be found on the UniProt database.

Imunogênio

Synthetic peptide directed towards the N terminal region of human TNNT2

Ações bioquímicas/fisiológicas

TNNT2 is the tropomyosin-binding subunit of the troponin complex, which is located on the thin filament of striated muscles and regulates muscle contraction in response to alterations in intracellular calcium ion concentration. Mutations in the gene encoding TNNT2 have been associated with familial hypertrophic cardiomyopathy as well as with dilated cardiomyopathy. The protein encoded by this gene is the tropomyosin-binding subunit of the troponin complex, which is located on the thin filament of striated muscles and regulates muscle contraction in response to alterations in intracellular calcium ion concentration. Mutations in this gene have been associated with familial hypertrophic cardiomyopathy as well as with dilated cardiomyopathy. Transcripts for this gene undergo alternative splicing that results in many tissue-specific isoforms, however, the full-length nature of some of these variants has not yet been determined.

Sequência

Synthetic peptide located within the following region: ESKPKPRSFMPNLVPPKIPDGERVDFDDIHRKRMEKDLNELQALIEAHFE

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Alexander J Sparrow et al.
Circulation research, 124(8), 1228-1239 (2019-02-09)
Subcellular Ca2+ indicators have yet to be developed for the myofilament where disease mutation or small molecules may alter contractility through myofilament Ca2+ sensitivity. Here, we develop and characterize genetically encoded Ca2+ indicators restricted to the myofilament to directly visualize

Questions

Reviews

No rating value

Active Filters

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica