The immunogen for anti-HSD17B11 antibody: synthetic peptide derected towards the middle region of human HSD17B11
Ações bioquímicas/fisiológicas
Hsd17b11 can convert androstan-3-alpha,17-beta-diol (3-alpha-diol) to androsterone in vitro, suggesting that it may participate in androgen metabolism during steroidogenesis. Hsd17b11 may act by metabolizing compounds that stimulate steroid synthesis and/or by generating metabolites that inhibit it. It has no activity toward DHEA (dehydroepiandrosterone), or A-dione (4-androste-3,17-dione), and only a slight activity toward testosterone to A-dione.
Sequência
Synthetic peptide located within the following region: IYSAAKKVKEEVGDVSILVNNAGVVYTADLFATQDPQIEKTFEVNVLAHF
forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Exoneração de responsabilidade
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Não está encontrando o produto certo?
Experimente o nosso Ferramenta de seleção de produtos.
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
