Pular para o conteúdo
Merck
Todas as fotos(1)

Documentos Principais

SAB2104121

Sigma-Aldrich

Anti-CHAC2, (N-terminal) antibody produced in rabbit

affinity isolated antibody

Faça loginpara ver os preços organizacionais e de contrato

Selecione um tamanho

100 μL
R$ 3.345,00

R$ 3.345,00


Check Cart for Availability


Selecione um tamanho

Alterar visualização
100 μL
R$ 3.345,00

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

R$ 3.345,00


Check Cart for Availability

fonte biológica

rabbit

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

peso molecular

21 kDa

reatividade de espécies

guinea pig, human, mouse, dog, rat, rabbit, bovine

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão NCBI

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... CHAC2(494143)

Descrição geral

Glutathione-specific γ-glutamylcyclotransferase 2 (ChaC2) belongs to the ChaC family of γ-glutamylcyclotransferases.[1] It carries a methionine (Met) residue at the N-terminus.

Imunogênio

Synthetic peptide directed towards the N terminal region of human CHAC2

Aplicação

Anti-CHAC2, (N-terminal) antibody produced in rabbit has been used in western blot.[1]

Ações bioquímicas/fisiológicas

Glutathione-specific γ-glutamylcyclotransferase 2 (ChaC2) helps in degrading glutathione in the cytosol of mammals.[1] In pathways that are independent of ChaC1, ChaC2 would disrupt the expression of nuclear erythroid-2-like factor (Nrf2) and glutamate cysteine ligase. Upregulation of ChaC2 gene can prevent the proliferation of cells. It may be considered as a candidate tumor suppressor gene (TSG) in gastrointestinal cancer.

Sequência

Synthetic peptide located within the following region: MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVV

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Shuiping Liu et al.
Cell death & disease, 8(8), e3009-e3009 (2017-08-25)
Tumor suppressor genes play a key role in cancer pathogenesis. Through massive expression profiling we identified CHAC2 as a frequently downregulated gene in gastric and colorectal cancers. Immunohistochemistry and western blot revealed that CHAC2 was downregulated in most tumor tissues
Yen T K Nguyen et al.
Biomolecules, 10(1) (2019-12-28)
Glutathione (GSH) degradation plays an essential role in GSH homeostasis, which regulates cell survival, especially in cancer cells. Among human GSH degradation enzymes, the ChaC2 enzyme acts on GSH to form 5-l-oxoproline and Cys-Gly specifically in the cytosol. Here, we
Amandeep Kaur et al.
The Journal of biological chemistry, 292(2), 638-651 (2016-12-04)
Glutathione degradation plays an important role in glutathione and redox homeostasis, and thus it is imperative to understand the enzymes and the mechanisms involved in glutathione degradation in detail. We describe here ChaC2, a member of the ChaC family of

Questions

Reviews

No rating value

Active Filters

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica