SAB2101648

Anti-NR2F2 antibody produced in rabbit

affinity isolated antibody, lyophilized powder

• Sinônimo(s): Anti-ARP1, Anti-COUP-TFII, Anti-COUPTFB, Anti-MGC117452, Anti-Nuclear receptor subfamily 2, group F, member 2
• Número MDL: MFCD07370450
• Código UNSPSC: 12352203

Propriedades

• fonte biológica: rabbit
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• Formulário: lyophilized powder
• peso molecular: 45 kDa
• reatividade de espécies: mouse, human, bovine, canine, rabbit, rat, chicken
• técnica(s): western blot: suitable
• sequência de imunogênio: MAMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPAS
• nº de adesão UniProt: P24468
• temperatura de armazenamento: −20°C
• Informações sobre genes: human ... NR2F2(7026)

Descrição

Imunogênio

Peptide region of the protein sequence according to NP_066285.

forma física

Lyophilized from PBS buffer with 2% sucrose

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 13 - Non Combustible Solids
• Classe de risco de água (WGK): WGK 2
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable