Pular para o conteúdo
Merck
Todas as fotos(3)

Key Documents

SAB2101578

Sigma-Aldrich

Anti-NFATC3 antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-NFAT4, Anti-NFATX, Anti-Nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(3)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

forma

buffered aqueous solution

peso molecular

115 kDa

reatividade de espécies

dog, mouse, human, horse, bovine

concentração

0.5 mg - 1 mg/mL

técnica(s)

immunohistochemistry: suitable
western blot: suitable

nº de adesão UniProt

Q12968

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... NFATC3(4775)

Descrição geral

The nuclear factor of activated T cells 3 (NFATc3)/nuclear factor of activated T cells 4 (NFAT4) belongs to the NFAT family. It is expressed at high levels in the thymus. NFATc3 has a rel similarity domain (RSD) and the SP repeat region, characterized by the repeated motif SPxxSPxxSPrxsxx(D/E)(D/E)swl. The NFATc3 gene is located on human chromosome 16.

Imunogênio

Synthetic peptide directed towards the N terminal region of human NFATC3

Aplicação

Anti-NFATC3 antibody produced in rabbit has been used in western blot analysis (1:1000).

Ações bioquímicas/fisiológicas

The nuclear factor of activated T cells 3 (NFATc3)/nuclear factor of activated T cells 4 (NFAT4) exhibits either pro-tumor or anti-tumor effects. It can block the proliferation and migration abilities of hepatoma cells. NFATc3 aids in reducing hepatitis B virus (HBV) replication. It can activate transcription. NFAT4 is necessary to drive the expression of the human polyomavirus JC virus (JCV) gene in glial cells.

Sequência

Synthetic peptide located within the following region: AVFPFQYCVETDIPLKTRKTSEDQAAILPGKLELCSDDQGSLSPARETSI

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Xiaobin Zao et al.
Oncoimmunology, 10(1), 1869388-1869388 (2021-02-02)
Nuclear factor of activated T cells 3 (NFATc3) has been reported to upregulate type I interferons (IFNs) expression, and the abnormal expression and activation of NFATc3 were closely related to tumorigenesis. However, the potential function of NFATc3 in hepatitis B
S N Ho et al.
The Journal of biological chemistry, 270(34), 19898-19907 (1995-08-25)
Signals transduced by the T cell antigen receptor (TCR) regulate developmental transitions in the thymus and also mediate the immunologic activation of mature, peripheral T cells. In both cases TCR stimulation leads to the assembly of the NFAT transcription complex
Kate Manley et al.
Journal of virology, 80(24), 12079-12085 (2006-10-13)
The human polyomavirus JC virus (JCV) infects 70% of the population worldwide. In immunosuppressed patients, JCV infection can lead to progressive multifocal leukoencephalopathy (PML), a fatal demyelinating disease of the central nervous system (CNS). The majority of PML cases occur
Patrick Nasarre et al.
Cancers, 13(11) (2021-06-03)
Secreted frizzled-related protein 2 (SFRP2) promotes the migration/invasion of metastatic osteosarcoma (OS) cells and tube formation by endothelial cells. However, its function on T-cells is unknown. We hypothesized that blocking SFRP2 with a humanized monoclonal antibody (hSFRP2 mAb) can restore

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica