SAB1412608

ANTI-LBX1 antibody produced in mouse

clone 2G11, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): HPX-6, HPX6, LBX1, LBX1H, homeobox
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 2G11, monoclonal
• forma: buffered aqueous solution
• peso molecular: antigen 36.74 kDa
• reatividade de espécies: human
• técnica(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• nº de adesão NCBI: NM_006562
• nº de adesão UniProt: P52954
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... LBX1(10660)

Descrição

Descrição geral

This gene and the orthologous mouse gene were found by their homology to the Drosophila lady bird early and late homeobox genes. In the mouse, this gene is a key regulator of muscle precursor cell migration and is required for the acquisition of dorsal identities of forelimb muscles. (provided by RefSeq)

Imunogênio

LBX1 (NP_006553, 99 a.a. ~ 199 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LEVSVLQAAEGRDGMTIFGQRQTPKKRRKSRTAFTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDLEEMKADVESAKKLGP

forma física

Solution in phosphate buffered saline, pH 7.4

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable