SAB1409772

Monoclonal Anti-TWIST1 antibody produced in mouse

clone 4G10, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): ACS3, BPES2, BPES3, SCS, TWIST, bHLHa38
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 4G10, monoclonal
• forma: buffered aqueous solution
• peso molecular: antigen 37.07 kDa
• reatividade de espécies: human
• técnica(s): indirect ELISA: suitable; indirect immunofluorescence: suitable
• Isotipo: IgG2aκ
• nº de adesão NCBI: NM_000474
• nº de adesão UniProt: Q15672
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... TWIST1(7291)

Descrição

Descrição geral

Basic helix-loop-helix (bHLH) transcription factors have been implicated in cell lineage determination and differentiation. The protein encoded by this gene is a bHLH transcription factor and shares similarity with another bHLH transcription factor, Dermo1. The strongest expression of this mRNA is in placental tissue; in adults, mesodermally derived tissues express this mRNA preferentially. Mutations in this gene have been found in patients with Saethre-Chotzen syndrome. (provided by RefSeq)

Imunogênio

TWIST1 (NP_000465, 100 a.a. ~ 202 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH

forma física

Solution in phosphate buffered saline, pH 7.4

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable