SAB1409677

Monoclonal Anti-BMP7 antibody produced in mouse

clone 1E10, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): OP-1
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 1E10, monoclonal
• Formulário: buffered aqueous solution
• peso molecular: antigen 36.41 kDa
• reatividade de espécies: human
• técnica(s): indirect ELISA: suitable
• Isotipo: IgG2aκ
• nº de adesão NCBI: NM_001719
• nº de adesão UniProt: P18075
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... BMP7(655)

Descrição

Descrição geral

The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development and possible bone inductive activity. (provided by RefSeq)

Imunogênio

BMP7 (NP_001710, 293 a.a. ~ 390 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPET

Ações bioquímicas/fisiológicas

As implied by their name, bone morphogenetic proteins (BMPs) promote and regulate bone development and growth. BMP-7 induces apoptosis in B-cells. It has a role in organ development and may have a role in liver regeneration. Mutations in the gene encoding the protein have been shown to affect the development of teeth, palate and other orofacial complexes.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable