SAB1409556

Monoclonal Anti-PTH antibody produced in mouse

clone 4D7, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): PTH1
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 4D7, monoclonal
• forma: buffered aqueous solution
• peso molecular: antigen 9 kDa
• reatividade de espécies: human
• técnica(s): immunoprecipitation (IP): suitable; indirect ELISA: suitable
• Isotipo: IgG2aκ
• nº de adesão UniProt: P01270
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... PTH(5741)

Descrição

Descrição geral

The protein encoded by this gene is a hormone secreted by parathyroid cells. This hormone elevates blood Ca2+ level by dissolving the salts in bone and preventing their renal excretion. Defects in this gene are a cause of familial isolated hypoparathyroidism (FIH). (provided by RefSeq)

Imunogênio

PTH (NP_000306, 32 a.a.-115 a.a.) full-length recombinant protein.

Sequence
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ

forma física

Solution in phosphate buffered saline, pH 7.4

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable