SAB1405114

Monoclonal Anti-MYO3A antibody produced in mouse

clone 6D10, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): DFNB30
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 6D10, monoclonal
• Formulário: buffered aqueous solution
• peso molecular: antigen ~36.01 kDa
• reatividade de espécies: human
• técnica(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2bκ
• nº de adesão NCBI: NM_017433
• nº de adesão UniProt: Q8NEV4
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... MYO3A(53904)

Descrição

Descrição geral

The protein encoded by this gene belongs to the myosin superfamily. Myosins are actin-dependent motor proteins and are categorized into conventional myosins (class II) and unconventional myosins (classes I and III through XV) based on their variable C-terminal cargo-binding domains. Class III myosins, such as this one, have a kinase domain N-terminal to the conserved N-terminal motor domains and are expressed in photoreceptors. The protein encoded by this gene plays an important role in hearing in humans. Three different recessive, loss of function mutations in the encoded protein have been shown to cause nonsyndromic progressive hearing loss. Expression of this gene is highly restricted, with the strongest expression in retina and cochlea. (provided by RefSeq)

Imunogênio

MYO3A (NP_059129, 1400 a.a. ~ 1490 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
HEEINNIKKKDNKDSKATSEREACGLAIFSKQISKLSEEYFILQKKLNEMILSQQLKSLYLGVSHHKPINRRVSSQQCLSGVCKGEEPKIL

forma física

Solution in phosphate buffered saline, pH 7.4

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable