SAB1404851

Monoclonal Anti-TRIM16 antibody produced in mouse

clone 5G11, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): EBBP
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 5G11, monoclonal
• Formulário: buffered aqueous solution
• peso molecular: antigen ~38.1 kDa
• reatividade de espécies: human
• técnica(s): capture ELISA: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• nº de adesão NCBI: NM_006470
• nº de adesão UniProt: O95361
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... TRIM16(10626)

Descrição

Descrição geral

This gene was identified as an estrogen and anti-estrogen regulated gene in epithelial cells stably expressing estrogen receptor. The protein encoded by this gene contains two B box domains and a coiled-coiled region that are characteristic of the B box zinc finger protein family. The proteins of this family have been reported to be involved in a variety of biological processes including cell growth, differentiation and pathogenesis. Expression of this gene was detected in most tissues. Its function, however, has not yet been determined. (provided by RefSeq)

Imunogênio

TRIM16 (NP_006461, 165 a.a. ~ 273 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LDAARRDKEAELQCTQLDLERKLKLNENAISRLQANQKSVLVSVSEVKAVAEMQFGELLAAVRKAQANVMLFLEEKEQAALSQANGIKAHLEYRSAEMEKSKQELERMA

Ações bioquímicas/fisiológicas

The gene TRIM16 (tripartite motif containing 16), also referred to as estrogen-responsive B box protein (EBBP), encodes a protein that has the ability to heterodimerize with other TRIM proteins and also has E3 ubiquitin ligase activity. It is found to positively regulate transcriptional regulator of the retinoic acid receptor β2 (RARβ2) gene. Overexpression of trim16 facilitates retinoid-induced differentiation, reduces neuroblastoma cell growth, migration, and considerably decreases tumorigenicity in vivo.[1]

forma física

Solution in phosphate buffered saline, pH 7.4

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable