SAB1403985

Monoclonal Anti-IPF1 antibody produced in mouse

clone 4E12, purified immunoglobulin, buffered aqueous solution

• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 4E12, monoclonal
• Formulário: buffered aqueous solution
• peso molecular: antigen ~37 kDa
• reatividade de espécies: human
• técnica(s): immunofluorescence: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG
• nº de adesão NCBI: NM_000209
• nº de adesão UniProt: P52945
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... PDX1(3651)

Descrição

Descrição geral

The protein encoded by this gene is a transcriptional activator of several genes, including insulin, somatostatin, glucokinase, islet amyloid polypeptide, and glucose transporter type 2. The encoded nuclear protein is involved in the early development of the pancreas and plays a major role in glucose-dependent regulation of insulin gene expression. Defects in this gene are a cause of pancreatic agenesis, which can lead to early-onset insulin-dependent diabetes mellitus (NIDDM), as well as maturity onset diabetes of the young type 4 (MODY4). (provided by RefSeq)

Imunogênio

IPF1 (NP_000200, 109 a.a. ~ 208 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LEEPNRVQLPFPWMKSTKAHAWKGQWAGGAYAAEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKK

forma física

Solution in phosphate buffered saline, pH 7.4

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable