SAB1403798

Monoclonal Anti-F3 antibody produced in mouse

clone 4G4, ascites fluid

• Sinônimo(s): CD142, TF, TFA
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: ascites fluid
• tipo de produto de anticorpo: primary antibodies
• clone: 4G4, monoclonal
• peso molecular: antigen ~38.21 kDa
• reatividade de espécies: human
• técnica(s): indirect ELISA: suitable; western blot: 1:500-1:1000
• Isotipo: IgG2aκ
• nº de adesão NCBI: BC011029
• nº de adesão UniProt: P13726
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... F3(2152)

Descrição

Descrição geral

This gene encodes coagulation factor III which is a cell surface glycoprotein. This factor enables cells to initiate the blood coagulation cascades, and it functions as the high-affinity receptor for the coagulation factor VII. The resulting complex provides a catalytic event that is responsible for initiation of the coagulation protease cascades by specific limited proteolysis. Unlike the other cofactors of these protease cascades, which circulate as nonfunctional precursors, this factor is a potent initiator that is fully functional when expressed on cell surfaces. There are 3 distinct domains of this factor: extracellular, transmembrane, and cytoplasmic. This protein is the only one in the coagulation pathway for which a congenital deficiency has not been described. (provided by RefSeq)

Imunogênio

F3 (AAH11029, 45 a.a. ~ 154 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTK

forma física

Clear solution

Informações de segurança

• Código de classe de armazenamento: 11 - Combustible Solids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable