SAB1403712

Monoclonal Anti-CTLA4 antibody produced in mouse

clone 2F1, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): CD152, CELIAC3, CTLA-4, GSE, IDDM12
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 2F1, monoclonal
• Formulário: buffered aqueous solution
• peso molecular: antigen ~37.11 kDa
• reatividade de espécies: human
• técnica(s): capture ELISA: suitable; immunofluorescence: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• nº de adesão NCBI: NM_005214
• nº de adesão UniProt: P16410
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... CTLA4(1493)

Descrição

Descrição geral

The CTLA4 (cytotoxic T lymphocyte associated-4) gene is mapped to human chromosome 2q33. It is a glycoprotein found on T-cells and is homologous to CD28 (Cluster of Differentiation 28) at the juxtamembrane and cytoplasmic regions.

Imunogênio

CTLA4 (NP_005205, 36 a.a. ~ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMY

Ações bioquímicas/fisiológicas

The CTLA4 (cytotoxic T lymphocyte associated-4) gene encodes a membrane receptor on cytotoxic T-cells that functions in T-cell apoptosis. It is a strong inhibitor of T-cell activation. It may be associated with type 1 diabetes. The gene has been identified as a susceptibility locus for Graves′ disease. It may be involved in the pathogenesis of autoimmune disorders.

forma física

Solution in phosphate buffered saline, pH 7.4

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable