SAB1403429

Monoclonal Anti-ACRC, (C-terminal) antibody produced in mouse

clone 2E4, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): NAAR1
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 2E4, monoclonal
• Formulário: buffered aqueous solution
• peso molecular: antigen ~37.11 kDa
• reatividade de espécies: human
• técnica(s): capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• nº de adesão NCBI: NM_052957
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... ACRC(93953)

Descrição

Descrição geral

The gene ACRC (acidic repeat containing) is mapped to human chromosome Xq13.1 and contains at least 12 exons and 11 introns. It contains a characteristic acidic repeat region of 21 units of 8–10 amino acids. It is expressed ubiquitously, including skeletal muscle, liver, kidney, pancreas, heart, lung, and brain, with the highest expression in skeletal muscle.

Imunogênio

ACRC (NP_443189.1, 592 a.a. ~ 691 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
HEMCHAASWLIDGIHDSHGDAWKYYARKSNRIHPELPRVTRCHNYKINYKVHYECTGCKTRIGCYTKSLDTSRFICAKCKGSLVMVPLTQKDGTRIVPHV

Ações bioquímicas/fisiológicas

The gene ACRC (acidic repeat containing) is localized on a critical region that harbors the disease locus for X-linked dystonia parkinsonism (XDP). However, mutation analysis in this gene does not implicate it in the disease.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações de segurança

• Código de classe de armazenamento: 13 - Non Combustible Solids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable