SAB1403361

Monoclonal Anti-LENG4 antibody produced in mouse

clone 1D4, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): BB1, LENG4, LPIAT, hMBOA-7
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 1D4, monoclonal
• Formulário: buffered aqueous solution
• peso molecular: antigen ~36.78 kDa
• reatividade de espécies: human
• técnica(s): capture ELISA: suitable; indirect ELISA: suitable
• Isotipo: IgG2aκ
• nº de adesão NCBI: NM_024298
• nº de adesão UniProt: Q96N66
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... MBOAT7(79143)

Descrição

Descrição geral

Membrane bound O-acyltransferase domain containing 7 (MBOAT7) or LENG4 belongs to membrane-bound O-acyltransferase family. The gene encoding it is localized on human chromosome 19q13.42.

Mouse monoclonal antibody raised against a partial recombinant LENG4.

Imunogênio

LENG4 (NP_077274.2, 96 a.a. ~ 192 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TPTPFTNAVQLLLTLKLVSLASEVQDLHLAQRKEMASGFSKGPTLGLLPDVPSLMETLSYSYCYVGIMTGPFFRYRTYLDWLEQPFPGAVPSLRPLL

Ações bioquímicas/fisiológicas

Membrane bound O-acyltransferase domain containing 7 (MBOAT7) or LENG4 is an integral membrane protein important for reacylation of phospholipids. LENG4 is highly specific for arachidonoyl-coenzyme A and is involved in arachidonate recycling. It interacts with the small subunit of serine palmitoyltransferase a (ssSPTa). This interaction is important for LENG4-dependent incorporation of arachidonic acid into phosphatidylinositol.

forma física

Solution in phosphate buffered saline, pH 7.4

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable