SAB1402517

Monoclonal Anti-UBE2E3 antibody produced in mouse

clone 3E9, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): UBCH9, UbcM2
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 3E9, monoclonal
• forma: buffered aqueous solution
• peso molecular: antigen ~35.79 kDa
• reatividade de espécies: human
• técnica(s): capture ELISA: suitable; immunofluorescence: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• nº de adesão NCBI: NM_006357
• nº de adesão UniProt: Q969T4
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... UBE2E3(10477)

Descrição

Descrição geral

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein shares 100% sequence identity with the mouse and rat counterparts, which indicates that this enzyme is highly conserved in eukaryotes. Two alternatively spliced transcript variants encoding the same protein have been found for this gene. (provided by RefSeq)

Imunogênio

UBE2E3 (NP_006348, 65 a.a. ~ 152 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDN

forma física

Solution in phosphate buffered saline, pH 7.4

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable