SAB1402456

Monoclonal Anti-OSMR antibody produced in mouse

clone 3E12, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): MGC150626, MGC150627, MGC75127, OSMRB
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 3E12, monoclonal
• Formulário: buffered aqueous solution
• peso molecular: antigen ~37.11 kDa
• reatividade de espécies: human
• técnica(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2bκ
• nº de adesão NCBI: NM_003999
• nº de adesão UniProt: Q99650
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... OSMR(9180)

Descrição

Descrição geral

Oncostatin M receptor (OSMR) is a cell surface cytokine receptor. Oncostatin M and interleukin-31 are its ligands. The gene encoding this protein is localized on human chromosome 5p.

Imunogênio

OSMR (NP_003990.1, 141 a.a. ~ 240 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QDSTGQDILFVFPKDKLVEEGTNVTICYVSRNIQNNVSCYLEGKQIHGEQLDPHVTAFNLNSVPFIRNKGTNIYCEASQGNVSEGMKGIVLFVSKVLEEP

Ações bioquímicas/fisiológicas

Oncostatin M receptor (OSMR) acts as an activator of janus kinase/signal transducers and activators of transcription (JAK/STAT) and mitogen-activated protein kinase pathway. Thus, it has a role in stimulating cytokines and inflammatory substances. Mutation in the OSMR gene has been linked to primary localized cutaneous amyloidosis.

forma física

Solution in phosphate buffered saline, pH 7.4

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable