SAB1402266

Monoclonal Anti-MCM4 antibody produced in mouse

clone 1A6, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): CDC21, CDC54, MGC33310, P1-CDC21, hCdc21
• Número MDL: MFCD02263651
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 1A6, monoclonal
• forma: buffered aqueous solution
• peso molecular: antigen ~37 kDa
• reatividade de espécies: human
• técnica(s): indirect ELISA: suitable
• Isotipo: IgG2aκ
• nº de adesão NCBI: BC031061
• nº de adesão UniProt: P33991
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... MCM4(4173)

Descrição

Descrição geral

The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 6 and 7 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. The phosphorylation of this protein by CDC2 kinase reduces the DNA helicase activity and chromatin binding of the MCM complex. This gene is mapped to a region on the chromosome 8 head-to-head next to the PRKDC/DNA-PK, a DNA-activated protein kinase involved in the repair of DNA double-strand breaks. Alternatively spliced transcript variants encoding the same protein have been reported. (provided by RefSeq)

Imunogênio

MCM4 (AAH31061, 267 a.a. ~ 366 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KTKNMRNLNPEDIDQLITISGMVIRTSQLIPEMQEAFFQCQVCAHTTRVEMDRGRIAEPSVCGRCHTTHSMALIHNRSLFSDKQMIKLQESPEDMPAGQT

forma física

Solution in phosphate buffered saline, pH 7.4

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable