SAB1401873

Anti-INHBE antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): MGC4638
• Código UNSPSC: 12352203
• NACRES: NA.43

Propriedades

• fonte biológica: rabbit
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• Formulário: buffered aqueous solution
• reatividade de espécies: mouse, human
• técnica(s): immunoprecipitation (IP): suitable; western blot: 1 μg/mL
• nº de adesão NCBI: NM_031479
• nº de adesão UniProt: P58166
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... INHBE(83729)

Descrição

Descrição geral

Inhibin subunit beta E (INHBE) is a dimeric protein, which is majorly expressed in human liver. The gene is located on human chromosome 12q13.3.

Imunogênio

INHBE (NP_113667.1, 1 a.a. ~ 350 a.a) full-length human protein.

Sequence
MRLPDVQLWLVLLWALVRAQGTGSVCPSCGGSKLAPQAERALVLELAKQQILDGLHLTSRPRITHPPPQAALTRALRRLQPGSVAPGNGEEVISFATVTDSTSAYSSLLTFHLSTPRSHHLYHARLWLHVLPTLPGTLCLRIFRWGPRRRRQGSRTLLAEHHITNLGWHTLTLPSSGLRGEKSGVLKLQLDCRPLEGNSTVTGQPRRLLDTAGHQQPFLELKIRANEPGAGRARRRTPTCEPATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS

Ações bioquímicas/fisiológicas

Inhibin subunit beta E (INHBE) may be associated with carcinogenesis. Differential expression of INHBE in human endometrial tissue plays an important role in endometrial maturation and blastocyst implantation. The protein is a hepatokine linked to hepatic gene expression. It is associated with insulin resistance and body mass index in humans. The protein expression in liver is stimulated by insulin. It is involved in glucose metabolism.

Características e benefícios

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

forma física

Solution in phosphate buffered saline, pH 7.4

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable