Pular para o conteúdo
Merck
Todas as fotos(2)

Documentos Principais

SAB1401172

Sigma-Aldrich

Anti-CFH antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

Sinônimo(s):

ARMD4, ARMS1, CFHL3, FH, FHL1, HF

Faça loginpara ver os preços organizacionais e de contrato

Selecione um tamanho

100 μG
R$ 4.090,00

R$ 4.090,00


Check Cart for Availability


Selecione um tamanho

Alterar visualização
100 μG
R$ 4.090,00

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

R$ 4.090,00


Check Cart for Availability

fonte biológica

rabbit

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

purified immunoglobulin

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

reatividade de espécies

human

técnica(s)

western blot: 1 μg/mL

nº de adesão NCBI

nº de adesão UniProt

Condições de expedição

dry ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... CFH(3075)

Descrição geral

This gene is a member of the Regulator of Complement Activation (RCA) gene cluster and encodes a protein with twenty short concensus repeat (SCR) domains. This protein is secreted into the bloodstream and has an essential role in the regulation of complement activation, restricting this innate defense mechanism to microbial infections. Mutations in this gene have been associated with hemolytic-uremic syndrome (HUS) and chronic hypocomplementemic nephropathy. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. (provided by RefSeq)

Imunogênio

CFH (NP_001014975.1, 1 a.a. ~ 449 a.a) full-length human protein.

Sequence
MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVSFTL

Ações bioquímicas/fisiológicas

CFH (complement factor H) is a negative regulator of alternate pathway. It is known to suppress spontaneous complement activation on self surfaces alone, and is therefore surface selective. CFH possesses decay-accelerating activity and destabilizes C3b amplification in the alternate complement pathway. CFH is responsible for C3b cleavage by its cofactor activity. CFH is a membrane cofactor protein, variation in which is associated with a number of diseases such as age-related macular degeneration, kidney disorder and C3 glomerulopathy. The penetrance is found to be low in many diseases. CFH might prevent complement activation in ischaemic renal injury by binding to tubular epithelial cells.

forma física

Solution in phosphate buffered saline, pH 7.4

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Interaction of uromodulin and complement factor H enhances C3b inactivation.
Liu M
Journal of Cellular and Molecular Medicine, 20(10), 1821-1828 (2016)
Properdin and factor H production by human dendritic cells modulates their T-cell stimulatory capacity and is regulated by IFN-?.
Dixon KO
European Journal of Immunology, 47(3), 470-480 (2017)
Disease-linked mutations in factor H reveal pivotal role of cofactor activity in self-surface-selective regulation of complement activation.
Kerr H
The Journal of Biological Chemistry, 292(32), 13345-13360 (2017)
Karukriti Kaushik Ghosh et al.
Infection and immunity, 87(12) (2019-09-25)
Leptospirosis is one of the most widespread zoonoses caused by pathogenic Leptospira spp. In this study, we report that the LIC11966/ErpY-like lipoprotein is a surface-exposed outer membrane protein exclusively present in pathogenic species of Leptospira The recombinant ErpY (rErpY)-like protein

Questions

Reviews

No rating value

Active Filters

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica