SAB1400646
Anti-SH3GLB2 antibody produced in mouse
IgG fraction of antiserum, buffered aqueous solution
Sinônimo(s):
Anti-KIAA1848
Faça loginpara ver os preços organizacionais e de contrato
Selecione um tamanho
50 μG
R$ 4.090,00
R$ 4.090,00
Check Cart for Availability
Selecione um tamanho
Alterar visualização
50 μG
R$ 4.090,00
About This Item
Código UNSPSC:
12352203
NACRES:
NA.41
R$ 4.090,00
Check Cart for Availability
fonte biológica
mouse
conjugado
unconjugated
forma do anticorpo
IgG fraction of antiserum
tipo de produto de anticorpo
primary antibodies
clone
polyclonal
Formulário
buffered aqueous solution
reatividade de espécies
human
técnica(s)
immunofluorescence: suitable
western blot: 1 μg/mL
nº de adesão UniProt
Condições de expedição
dry ice
temperatura de armazenamento
−20°C
modificação pós-traducional do alvo
unmodified
Informações sobre genes
human ... SH3GLB2(56904)
Categorias relacionadas
Descrição geral
The gene SH3GLB2 (SH3 domain-containing GRB2-like protein B2) is mapped to human chromosome 9q34. The encoded protein belongs to the endophilin family of BAR and Src homology 3 domain-containing proteins. SH3GLB2 localizes in the meshwork of perinuclear filamentous structures. The protein contains an N-BAR (bin, amphiphysin and rvs) domain and a SH3 (src homology 3) domain.
Imunogênio
SH3GLB2 (NP_064530.1, 1 a.a. ~ 395 a.a) full-length human protein.
Sequence
MDFNMKKLASDAGIFFTRAVQFTEEKFGQAEKTELDAHFENLLARADSTKNWTEKILRQTEVLLQPNPSARVEEFLYEKLDRKVPSRVTNGELLAQYMADAASELGPTTPYGKTLIKVAEAEKQLGAAERDFIHTASISFLTPLRNFLEGDWKTISKERRLLQNRRLDLDACKARLKKAKAAEAKATTVPDFQETRPRNYILSASASALWNDEVDKAEQELRVAQTEFDRQAEVTRLLLEGISSTHVNHLRCLHEFVKSQTTYYAQCYRHMLDLQKQLGRFPGTFVGTTEPASPPLSSTSPTTAVATMPVVPSVASLAPPGEASLCLEEVAPPASGTRKARVLYDYEAADSSELALLADELITVYSLPGMDPDWLIGERGNKKGKVPVTYLELLS
Sequence
MDFNMKKLASDAGIFFTRAVQFTEEKFGQAEKTELDAHFENLLARADSTKNWTEKILRQTEVLLQPNPSARVEEFLYEKLDRKVPSRVTNGELLAQYMADAASELGPTTPYGKTLIKVAEAEKQLGAAERDFIHTASISFLTPLRNFLEGDWKTISKERRLLQNRRLDLDACKARLKKAKAAEAKATTVPDFQETRPRNYILSASASALWNDEVDKAEQELRVAQTEFDRQAEVTRLLLEGISSTHVNHLRCLHEFVKSQTTYYAQCYRHMLDLQKQLGRFPGTFVGTTEPASPPLSSTSPTTAVATMPVVPSVASLAPPGEASLCLEEVAPPASGTRKARVLYDYEAADSSELALLADELITVYSLPGMDPDWLIGERGNKKGKVPVTYLELLS
Ações bioquímicas/fisiológicas
SH3GLB2 (SH3 domain-containing GRB2-like protein B2) associates with SH3GLB1. It also interacts with plectin-1 and vimentin. SH3GLB2 is involved in reorganization of vimentin around nuclei and nuclear positioning.
forma física
Solution in phosphate buffered saline, pH 7.4
Exoneração de responsabilidade
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Não está encontrando o produto certo?
Experimente o nosso Ferramenta de seleção de produtos.
Código de classe de armazenamento
10 - Combustible liquids
Ponto de fulgor (°F)
Not applicable
Ponto de fulgor (°C)
Not applicable
Escolha uma das versões mais recentes:
Certificados de análise (COA)
Lot/Batch Number
Não está vendo a versão correta?
Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.
Já possui este produto?
Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.
Oculo-Auriculo-Vertebral Spectrum: A Review of the Literature
Beleza-Meireles A, et al.
Journal of Genetic Syndromes & Gene Therapy, 5 (2014)
Roland Lehmann et al.
Mucosal immunology, 11(3), 627-642 (2018-01-04)
Protein secretion upon TLR, TNFR1, and IFNGR ligation in the human airways is considered to be central for the orchestration of pulmonary inflammatory and immune responses. In this study, we compared the gene expression and protein secretion profiles in response
Christian Vannier et al.
The Journal of biological chemistry, 288(38), 27619-27637 (2013-08-08)
Proteins of the Bin/amphiphysin/Rvs (BAR) domain superfamily are essential in controlling the shape and dynamics of intracellular membranes. Here, we present evidence for the unconventional function of a member of the endophilin family of BAR and Src homology 3 domain-containing
B Pierrat et al.
Genomics, 71(2), 222-234 (2001-02-13)
A new cDNA encoding a protein of 362 amino acids designated SH3GLB1, for SH3 domain GRB2-like endophilin B1, was identified in a yeast two-hybrid screen devoted to the identification of new partners interacting with the apoptosis inducer Bax. SH3GLB1 shows
Active Filters
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
Entre em contato com a assistência técnica
