QPREST21414

SILu^™PrEST PLXC1

SILuPrESTs Powered by Atlas Antibodies, buffered aqueous solution

• Sinônimo(s): Virus-encoded semaphorin protein receptor
• Código UNSPSC: 12352200

Propriedades

• recombinante: expressed in E. coli LysA ArgA BL21(DE3)
• Ensaio: >80% (SDS-PAGE)
• Formulário: buffered aqueous solution
• peso molecular: predicted mol wt 30kDa including tags
• purificado por: immobilized metal affinity chromatography (IMAC)
• embalagem: pkg of 1nmol × 5 vials
• condição de armazenamento: avoid repeated freeze/thaw cycles
• sequência de imunogênio: SKELSRKQSQQLELLESELRKEIRDGFAELQMDKLDVVDSFGTVPFLDYKHFALRTFFPESGGFTHIFTEDMHNRDANDKNESLTALDALICNKSFLVTVIHTL
• nº de adesão do atlas de peptídeos: PAp01123803; PAp01659985; PAp01667242
• nº de adesão UniProt: O60486
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• Informações sobre genes: human ... PLXC1(10154)

Descrição

Descrição geral

Lys, Arg ¹³C and ¹⁵N metabolically labeled recombinant human protein fragment

Aplicação

Internal standard in MS-based quantitative proteomics

forma física

Heavy proteins are provided in solution of 1M Urea PBS, pH 7.4

Nota de preparo

The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.

Nota de análise

Isotopic Label Incorporation

The SILuPrEST standards are produced using metabolic labeling with heavy isotope labeled (15N, 13C) Lysine and Arginine residues, with greater than 99% isotopic label incorporation.

A purification and quantification tag (QTag) consisting of a hexahistidine (His6) sequence followed by an Albumin Binding Protein (ABP) domain derived from Streptococcal Protein G.

All SILuPrESTs contain an N-terminal His6ABP fusion tag, used for accurate determination of concentration. The fusion tag sequence is:

GSSHHHHHHSSGLVPRGSHMASLAEAKVLANRELDKYGVSDYHKNLINNAKTVEGVKDLQAQVVESAKKARISEATDGLSDFLKSQTPAEDTVKSIELAEAKVLANRELDKYGVSDYYKNLINNAKTVEGVKALIDEILAALPGTFAHYMDPNSSSVDKLAAA.

The specific human protein sequence begins directly after ′VDKLAAA′.

Informações legais

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), [email protected]

SILu is a trademark of Sigma-Aldrich Co. LLC

Informações de segurança

• Código de classe de armazenamento: 12 - Non Combustible Liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable