HPA044948
Anti-MIIP antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Sinônimo(s):
Anti-Flj12438, Anti-Iip45, Anti-Migration and invasion inhibitory protein
Faça loginpara ver os preços organizacionais e de contrato
About This Item
Produtos recomendados
fonte biológica
rabbit
Nível de qualidade
conjugado
unconjugated
forma do anticorpo
affinity isolated antibody
tipo de produto de anticorpo
primary antibodies
clone
polyclonal
linha de produto
Prestige Antibodies® Powered by Atlas Antibodies
forma
buffered aqueous glycerol solution
reatividade de espécies
human
técnica(s)
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500
sequência de imunogênio
SDTLALPRHCLLGWDIFPPKSEKSSAPRNLDLWSSVSAEAQHQKLSGTSSPFHPASPMQMLPPTPTWSVPQVPRPHVPRQKP
nº de adesão UniProt
Condições de expedição
wet ice
temperatura de armazenamento
−20°C
modificação pós-traducional do alvo
unmodified
Informações sobre genes
human ... MIIP(60672)
Descrição geral
Migration and invasion inhibitory protein (MIIP), also called insulin-like growth factor binding protein 2 (IGFBP2), is expressed in fetal tissues and astroglial cells. It has an insulin-like growth factor (IGF) binding motif. It is a tumor-suppressor gene and is mapped to human chromosome 1p36.22. It has a C-terminal polyproline domain.
Imunogênio
migration and invasion inhibitory protein recombinant protein epitope signature tag (PrEST)
Aplicação
Anti-MIIP antibody produced in rabbit has been used in western blotting and in immunoprecipitation detection of MIIP in colorectal cancer cells.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)
Immunohistochemistry (1 paper)
Ações bioquímicas/fisiológicas
Migration and invasion inhibitory protein (MIIP), binds to insulin-like growth factor (IGF) and modulates cancer progression. It is under expressed in brain tumor, invasive glioblastoma multiforme. MIIP is a tumor suppressor gene and inhibits rat sarcoma (Ras)-related C3 botulinum toxin substrate 1- guanosine triphosphate (Rac1-GTP) mediated cell migration in endometrial carcinoma. Single nucleotide polymorphism in MIIP is associated with increased risk of breast cancer. MIIP inhibits non-small cell lung cancer progression by lowering epidermal growth factor receptor (EGFR) expression. Haploinsufficiency of MIIP is implicated in the colorectal tumor progression.
Características e benefícios
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Ligação
Corresponding Antigen APREST76605
forma física
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Informações legais
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Exoneração de responsabilidade
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Não está encontrando o produto certo?
Experimente o nosso Ferramenta de seleção de produtos.
Código de classe de armazenamento
10 - Combustible liquids
Classe de risco de água (WGK)
WGK 1
Ponto de fulgor (°F)
Not applicable
Ponto de fulgor (°C)
Not applicable
Certificados de análise (COA)
Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.
Já possui este produto?
Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.
IIp45, an insulin-like growth factor binding protein 2 (IGFBP-2) binding protein, antagonizes IGFBP-2 stimulation of glioma cell invasion
Song SW, et al.
Proceedings of the National Academy of Sciences of the USA, 100(24), 13970-13975 (2003)
PRP4 kinase induces actin rearrangement and epithelial-mesenchymal transition through modulation of the actin-binding protein cofilin
Islam SU, et al.
Experimental Cell Research, 369(1), 158-165 (2018)
Yan Sun et al.
The Journal of pathology, 241(1), 67-79 (2016-10-16)
The gene encoding migration and invasion inhibitory protein (MIIP), located on 1p36.22, is a potential tumour suppressor gene in glioma. In this study, we aimed to explore the role and mechanism of action of MIIP in colorectal cancer (CRC). MIIP
MIIP remodels Rac1-mediated cytoskeleton structure in suppression of endometrial cancer metastasis
Wang Y, et al.
Journal of Hematology & Oncology, 9(1), 112-112 (2016)
MIIP accelerates epidermal growth factor receptor protein turnover and attenuates proliferation in non-small cell lung cancer
Wen J, et al.
Oncotarget, 7(8), 9118-9134 (2016)
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
Entre em contato com a assistência técnica