HPA036119

Anti-CHMP7 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinônimo(s): Anti-CHMP family, member 7, Anti-MGC29816
• Código UNSPSC: 12352203
• Número do Atlas de Proteínas Humanas: HPA036119

Propriedades

• fonte biológica: rabbit
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• linha de produto: Prestige Antibodies^® Powered by Atlas Antibodies
• Formulário: buffered aqueous glycerol solution
• reatividade de espécies: mouse, human, rat
• técnica(s): immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:500-1:1000
• sequência de imunogênio: LALRSLKAKQRTEKRIEALHAKLDTVQGILDRIYASQTDQMVFNAYQAGVGALKLSMKDVTVEKAESLVDQIQELCDTQDEVSQTL
• nº de adesão UniProt: Q8WUX9
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• Informações sobre genes: human ... CHMP7(91782)

Descrição

Descrição geral

The gene CHMP7 (charged multivesicular body protein 7) is mapped to human chromosome 8p. The encoded protein has an SNF7 (sucrose non-fermenting protein 7) domain and a distantly SNF7-related domain. It belongs to the CHMP family of proteins.

Imunogênio

CHMP family, member 7 recombinant protein epitope signature tag (PrEST)

Aplicação

Anti-FGF19 antibody produced in rabbit has been used for western blotting.

Ações bioquímicas/fisiológicas

CHMP7 (charged multivesicular body protein 7) is a CHMP4-associated ESCRT-III (endosomal sorting complex required for transport)-related protein. It might have a role in endosomal sorting. During nuclear envelope formation, it participates in the recruitment of ESCRT-III to the envelope. The amino terminal tandem winged helix (WH)-domains allow CHMP7 association with endoplasmic reticulum and thereby help in ESCRT-III recruitment to nuclear envelope. Mutations in the CHMP7 gene prevent proper post-mitotic nucleo-cytoplasmic compartmentalization.

Características e benefícios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST76258.

forma física

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable