HPA036070

Anti-PTK6 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinônimo(s): Anti-BRK, Anti-PTK6 protein tyrosine kinase 6
• Código UNSPSC: 12352203
• Número do Atlas de Proteínas Humanas: HPA036070
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• linha de produto: Prestige Antibodies^® Powered by Atlas Antibodies
• Formulário: buffered aqueous glycerol solution
• reatividade de espécies: human
• validação aprimorada: recombinant expression; Learn more about Antibody Enhanced Validation
• técnica(s): immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:50-1:200
• sequência de imunogênio: PYPGMSNHEAFLRVDAGYRMPCPLECPPSVHKLMLTCWCRDPEQRPCFKALRERLSSFTSYENPT
• nº de adesão UniProt: Q13882
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... PTK6(5753)

Descrição

Descrição geral

PTK6 (protein tyrosine kinase 6) belongs to intracellular tyrosine kinases family. It is normally expressed in epithelial cells of skin, gastrointestinal tract and prostate. It is also called as breast tumor kinase (brk), for its critical role in progression of breast cancer. The PTK6 gene is located on the human chromosome 20q13.33. PTK6 protein is expressed in two isoforms.

Imunogênio

PTK6 protein tyrosine kinase 6 recombinant protein epitope signature tag (PrEST)

Aplicação

Anti-PTK6 rabbit polyclonal antibody has been used in microarray analysis of PTK6 in breast tumor samples. It may also be used to detect protein tyrosine kinase 6 using western blot analysis in esophageal squamous cell carcinoma.

Ações bioquímicas/fisiológicas

Protein tyrosine kinase 6 regulates epithelial cell gene expression by modulating RNA binding proteins. It favours epidermal growth factor receptor signalling cascade. Mutations in kinase domain leads to activity suppression. PTK6 is effectively inhibited by tumor suppressor protein phosphatase and tensin homolog (PTEN) in human prostate cancer tissues and cell lines. PTK6 is highly expressed and up-regulated in a multitude of human carcinomas including hepatocellular carcinoma, cervical squamous carcinoma, prostate cancer and colon cancer. PTK6 mediates proteasome-mediated degradation of tumor suppressor protein by phosphorylation. With the advent of its association in human cancer, PTK6 is considered as a potential drug target for cancer chemotherapy.

Características e benefícios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST78020

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable