HPA023026

Anti-WRAP53 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinônimo(s): Anti-FLJ10385, Anti-TCAB1, Anti-WD repeat containing, antisense to TP53, Anti-WDR79
• Código UNSPSC: 12352203
• Número do Atlas de Proteínas Humanas: HPA023026
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• linha de produto: Prestige Antibodies^® Powered by Atlas Antibodies
• forma: buffered aqueous glycerol solution
• reatividade de espécies: human
• validação aprimorada: recombinant expression; independent; orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• técnica(s): immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:20-1:50; western blot: 0.04-0.4 μg/mL
• sequência de imunogênio: GSLSEEEANGPELGSGKAMEDTSGEPAAEDEGDTAWNYSFSQLPRFLSGSWSEFSTQPENFLKGCKWAPDGSCILTNSADNILRIYNLPPELYHEGEQVEYAEMVPVLRMVEGDTIYDYC
• nº de adesão UniProt: Q9BUR4
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... WRAP53(55135)

Descrição

Descrição geral

WRAP53 (WD repeat containing, antisense to TP53) can result in three isoforms: α, β and γ. It is present in Cajal bodies. The gene is mapped to human chromosome 17p13.

Imunogênio

WD repeat containing, antisense to TP53 recombinant protein epitope signature tag (PrEST)

Aplicação

Anti-WRAP53 Prestige Antibodies^® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Ações bioquímicas/fisiológicas

WRAP53 (WD repeat containing, antisense to TP53) results in the formation of p53 antisense transcripts, which controls p53 mRNA expression. It is upregulated in esophageal squamous cell carcinoma and is associated with progression of the carcinoma. WRAP53 is also needed for telomere addition via telomerase. It is important for the assembly and trafficking of the telomerase holo-enzyme. It also participates in double starnd break repair and provides a scaffold for the factors involved in DNA repair. Mutations in WRAP53 result in dyskeratosis congenital.

Características e benefícios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST75665

forma física

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable