HPA018499

Anti-USP4 antibody produced in rabbit

affinity isolated antibody, buffered aqueous glycerol solution

• Sinônimo(s): Anti-Deubiquitinating enzyme 4, Anti-Ubiquitin carboxyl-terminal hydrolase 4, Anti-Ubiquitin thioesterase 4, Anti-Ubiquitin-specific-processing protease 4, Anti-Ubiquitous nuclear protein homolog
• Código UNSPSC: 12352203
• Número do Atlas de Proteínas Humanas: HPA018499
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• forma: buffered aqueous glycerol solution
• reatividade de espécies: human
• técnica(s): immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:200-1:500
• sequência de imunogênio: NMVVADVYNHRFHKIFQMDEGLNHIMPRDDIFVYEVCSTSVDGSECVTLPVYFRERKSRPSSTSSASALYGQPLLLSVPKHKLTLESLYQAVCDRISRYVKQPLPDEFGSSPL
• nº de adesão UniProt: Q13107
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... USP4(7375)

Descrição

Descrição geral

The gene USP4 (ubiquitin carboxyl-terminal hydrolase-4) is mapped to human chromosome 3p21.3. The protein is present in the cytoplasm and the nucleus.

Imunogênio

Ubiquitin carboxyl-terminal hydrolase 4 recombinant protein epitope signature tag (PrEST)

Aplicação

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Ações bioquímicas/fisiológicas

USP proteins are mainly responsible for deubiquitination of target proteins. Ubiquitin carboxyl-terminal hydrolase-4 (USP4) binds and deubiquitinates retinoic acid-inducible gene 1 (RIG1), thereby positively regulating RIG1-mediated antiviral response. USP4 deubiquitinates TRAF6 (TNF receptor-associated factor 6) and prevents the activation of NF (Nuclear factor)-κB and AP-1 (Activator protein-1) transcription factors, and subsequent innate immune activation. USP4 mRNA is elevated in small cell tumors and adenocarcinomas of the lung. USP4 is up-regulated in head and neck squamous cell carcinoma (HNSCC) and promotes tumor necrosis factor-α-induced apoptosis in HNSCC.

Características e benefícios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST86202

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable