HPA015315

Anti-WHSC1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinônimo(s): Anti-Multiple myeloma SET domain-containing protein, Anti-Nuclear SET domain-containing protein 2, Anti-Probable histone-lysine N-methyltransferase NSD2, Anti-Protein trithorax-5, Anti-Wolf-Hirschhorn syndrome candidate 1 protein
• Código UNSPSC: 12352203
• Número do Atlas de Proteínas Humanas: HPA015315

Propriedades

• fonte biológica: rabbit
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• linha de produto: Prestige Antibodies^® Powered by Atlas Antibodies
• Formulário: buffered aqueous glycerol solution
• reatividade de espécies: human
• técnica(s): immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect immunofluorescence: suitable; western blot: suitable
• sequência de imunogênio: QAPTKAEKIKLLKPISGKLRAQWEMGIVQAEEAASMSVEERKAKFTFLYVGDQLHLNPQVAKEAGIAAESLGEMAESSGVSEEAAENPKSVREECIPMKRRRRAKLCSSA
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• Informações sobre genes: human ... WHSC1(7468)

Descrição

Descrição geral

WHSC1 (Wolf-Hirschhorn syndrome candidate 1) is an oncogene belonging to the SET domain containing NSD (nuclear receptor binding SET domain) protein family. It produces several different isoforms, with the predominant being MMSETII (Multiple Myeloma SET Domain), which resides in the nucleus. Another common isoform is called REIIBP (interleukin-5 [IL-5] response element II binding protein), which is localized to cytoplasm and nucleus both. This gene also codes for highly expressed ACA11, which is a small nucleolar RNA (snoRNA). This gene is composed of 24 exons, spans 120kb, and codes for 1365 amino acid MMSETII.

Imunogênio

Probable histone-lysine N-methyltransferase NSD2 recombinant protein epitope signature tag (PrEST)

Aplicação

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Ações bioquímicas/fisiológicas

WHSC1 (Wolf-Hirschhorn syndrome candidate 1) is involved in the regulation of apoptosis, cell cycle and cell adhesion. It is involved in the dimethylation of H3K36, and MMSETII is involved in the histone methylation of H3K4, H3K27, H3K36 and H4K20. This functionality of this protein is mediated through its SET domain. Chromosomal translocation t(4;14) of this gene is implicated in multiple myeloma (MM), and correlates with poor prognosis. In gastric cancer, the mRNA levels of WHSC1 are related to the response to first-line FOLFOX (Folinic acid, Fluorouracil (5-FU), Oxaliplatin) and second-line docetaxel therapy. Therefore, this gene can be used to determine chemotherapy in gastric cancer cases.

Características e benefícios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST73692.

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Informações de segurança

• Código de classe de armazenamento: 12 - Non Combustible Liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)