Pular para o conteúdo
Merck
Todas as fotos(6)

Documentos Principais

HPA011165

Sigma-Aldrich

Anti-SIRT2 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinônimo(s):

Anti-NAD-dependent deacetylase sirtuin-2, Anti-SIR2-like, Anti-SIR2-like protein 2

Faça loginpara ver os preços organizacionais e de contrato

Selecione um tamanho

100 μL
R$ 4.140,00

R$ 4.140,00


Check Cart for Availability


Selecione um tamanho

Alterar visualização
100 μL
R$ 4.140,00

About This Item

Código UNSPSC:
12352203
Número do Atlas de Proteínas Humanas:
NACRES:
NA.41

R$ 4.140,00


Check Cart for Availability

fonte biológica

rabbit

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

linha de produto

Prestige Antibodies® Powered by Atlas Antibodies

Formulário

buffered aqueous glycerol solution

reatividade de espécies

human

validação aprimorada

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

técnica(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000

sequência de imunogênio

KDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLL

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... SIRT2(22933)

Descrição geral

SIRT2 (sirtuin 2) is a member of a highly conserved protein family called sirtuins. In humans, there are 7 members in this family, from sirtuin1-7. This gene is localized to human chromosome 19q13.2. SIRT2 protein has a helical N-terminal made of 19 amino acids, and a catalytic core made of 304 amino acids. The core region consists of two domains- the larger domain contains a Rossmann fold variant, and the smaller domain contains a zinc atom. This protein resides in the cytoplasm. However, studies show that an alternatively spliced variant of SIRT2, isoform 5, lacks a nuclear export signal and is constitutively localized to the nucleus.

Imunogênio

NAD-dependent deacetylase sirtuin-2 recombinant protein epitope signature tag (PrEST)

Aplicação

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Ações bioquímicas/fisiológicas

SIRT2 (sirtuin 2) is an NAD+ (nicotinamide adenine dinucleotide)-dependent deacetylase which uses tubulin as its substrate. It is implicated in monitoring mitosis and normal progression of cell cycle. It might be involved in cell cycle checkpoint, and respond to mitotic stress. It prevents chromosomal condensation in response to mitotic stress and thus maintains chromosomal stability. This protein is down-regulated in gliomas, and might act as a tumor suppressor by modulating microtubule network. Studies show that SIRT2 is implicated in the anti-proliferative effects of resveratrol on human glioblastoma stem cells, and therefore, might have potential as a therapeutic target. In neurons with oxidative stress, down-regulation of SIRT2 is responsible for modified microtubule dynamics due to alterations in tubulin deacetylation. Therefore, it might be implicated in Parkinson′s disease. Meta-analysis shows that SNP in this gene is involved in the pathogenesis of Alzheimer′s disease with APOE ε4 status.

Características e benefícios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST71542

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 1

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Equipamento de proteção individual

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Wenjin Wei et al.
Neuromolecular medicine, 16(2), 448-456 (2014-02-06)
Previous studies have reported an association between human sirtuins' single-nucleotide polymorphisms (SNPs) and Alzheimer's disease (AD) susceptibility in the apolipoprotein E (APOE) ε4-negative population, although the findings are inconsistent. To obtain a more precise estimation of this relationship, we conducted
Johannes G M Rack et al.
Journal of molecular biology, 426(8), 1677-1691 (2013-11-02)
Sirtuin-2 (SIRT2), the cytoplasmic member of the sirtuin family, has been implicated in the deacetylation of nuclear proteins. Although the enzyme has been reported to be located to the nucleus during G2/M phase, its spectrum of targets suggests functions in
Yanhua Du et al.
Molecular medicine reports, 15(4), 1638-1646 (2017-03-06)
The silent information regulator 2 related enzyme 2 (SIRT2) has been reported to have an important role in tumorigenesis. Although two distinct effects of SIRT2 have recently been revealed, which explain opposing expression patterns in different types of cancer, the
M S Finnin et al.
Nature structural biology, 8(7), 621-625 (2001-06-28)
Sir2 is an NAD-dependent histone deacetylase that mediates transcriptional silencing at mating-type loci, telomeres and ribosomal gene clusters, and has a critical role in the determination of life span in yeast and Caenorhabditis elegans. The 1.7 A crystal structure of
P K Bajpe et al.
Oncogene, 34(4), 531-536 (2014-01-29)
Resistance to targeted therapies is a major problem in cancer treatment. The epidermal growth factor receptor (EGFR) antibody drugs are effective in a subset of colorectal cancers, but the molecular mechanisms of resistance are understood poorly. Genes involved in epigenetic

Questions

Reviews

No rating value

Active Filters

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica