HPA010553
Anti-MFAP5 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Sinônimo(s):
Anti-MAGP-2, Anti-MFAP-5, Anti-MP25, Anti-Microfibril-associated glycoprotein 2, Anti-Microfibrillar-associated protein 5 precursor
Faça loginpara ver os preços organizacionais e de contrato
Selecione um tamanho
100 μL
R$ 4.140,00
R$ 4.140,00
Check Cart for Availability
Selecione um tamanho
Alterar visualização
100 μL
R$ 4.140,00
About This Item
R$ 4.140,00
Check Cart for Availability
Produtos recomendados
fonte biológica
rabbit
Nível de qualidade
conjugado
unconjugated
forma do anticorpo
affinity isolated antibody
tipo de produto de anticorpo
primary antibodies
clone
polyclonal
linha de produto
Prestige Antibodies® Powered by Atlas Antibodies
Formulário
buffered aqueous glycerol solution
reatividade de espécies
human
validação aprimorada
orthogonal RNAseq
recombinant expression
Learn more about Antibody Enhanced Validation
técnica(s)
immunohistochemistry: 1:500-1:1000
western blot: 0.04-0.4 μg/mL
sequência de imunogênio
GVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENV
nº de adesão UniProt
Condições de expedição
wet ice
temperatura de armazenamento
−20°C
modificação pós-traducional do alvo
unmodified
Informações sobre genes
human ... MFAP5(8076)
Categorias relacionadas
Descrição geral
MFAP5 (microfibrillar associated protein 5), also known as MAGP-2 (microfibril-associated glycoprotein 2) is a firbillin-interacting component of the ECM (extracellular matrix). It is found in elastin-associated or isolated microfibrills. MAGP1 and MAG2 form a family of small extracellular matrix microfibril-associated proteins.
Imunogênio
Microfibrillar-associated protein 5 precursor recombinant protein epitope signature tag (PrEST)
Aplicação
Anti-MFAP5 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry[1] against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting.[1] To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)
Western Blotting (1 paper)
Immunohistochemistry (1 paper)
Western Blotting (1 paper)
Ações bioquímicas/fisiológicas
MFAP5 (microfibrillar associated protein 5) interacts with multiple microfibrillar components, including fibrillin-1, fibrillin-2, fibulin-1, and tropoelastine, and thus participates in the physiology of ECM (extracellular matrix). Loss-of-function mutations in this gene lead to matrix aberration, which underlies the pathogenesis of familial thoracic aortic aneurysms and dissections. It is a marker of chondrocytes and distinguishes them from synovial cells. In endothelial cells, it acts as an antagonist of Notch signaling, thus, facilitating angiogenic cell spouting. MFAP5 protein influences the metastasis and invasion in ovarian cancer, which is mediated by FAK (focal adhesion kinase)/CREB (cAMP response element binding protein)/TNNC1 (troponin C Type 1) signaling. This protein also serves as a marker for poor prognosis in ovarian cancer.[1]
Características e benefícios
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Ligação
Corresponding Antigen APREST71369
forma física
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Informações legais
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Exoneração de responsabilidade
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Não está encontrando o produto certo?
Experimente o nosso Ferramenta de seleção de produtos.
Código de classe de armazenamento
10 - Combustible liquids
Classe de risco de água (WGK)
WGK 1
Ponto de fulgor (°F)
Not applicable
Ponto de fulgor (°C)
Not applicable
Equipamento de proteção individual
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Escolha uma das versões mais recentes:
Já possui este produto?
Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.
Qiaoshi Xu et al.
Journal of Cancer, 11(6), 1596-1605 (2020-02-13)
Objective: Microfibrillar-associated protein 5 (MFAP5) is highly expressed in many types of cancers. Our previous study has observed that overexpression of MFAP5 was correlated with lymph nodes metastasis and poor prognosis in head and neck squamous cell carcinoma (HNSCC), but
Mathieu Barbier et al.
American journal of human genetics, 95(6), 736-743 (2014-12-01)
Thoracic aortic aneurysm and dissection (TAAD) is an autosomal-dominant disorder with major life-threatening complications. The disease displays great genetic heterogeneity with some forms allelic to Marfan and Loeys-Dietz syndrome, and an important number of cases still remain unexplained at the
Katarzyna Aleksandra Kujawa et al.
International journal of molecular sciences, 23(24) (2022-12-24)
Ovarian cancer (OC) is usually diagnosed late due to its nonspecific symptoms and lack of reliable tools for early diagnostics and screening. OC studies concentrate on the search for new biomarkers and therapeutic targets. This study aimed to validate the
Stephen Rapko et al.
Tissue engineering. Part C, Methods, 16(6), 1367-1375 (2010-03-30)
Methods for the lineage identification of cell or tissue-engineered therapeutics must provide a high degree of performance to confidently distinguish the intended cell type from other lineages that could be present in the finished product. For many applications, these methods
Allan R Albig et al.
Microvascular research, 76(1), 7-14 (2008-04-18)
Angiogenesis is highly sensitive to the composition of the vascular microenvironment, however, our understanding of the structural and matricellular components of the vascular microenvironment that regulate angiogenesis and the molecular mechanisms by which these molecules function remains incomplete. Our previous
Active Filters
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
Entre em contato com a assistência técnica
