HPA009065
Anti-SOX7 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Sinônimo(s):
Anti-Transcription factor SOX-7
Faça loginpara ver os preços organizacionais e de contrato
Selecione um tamanho
100 μL
R$ 4.140,00
R$ 4.140,00
Check Cart for Availability
Selecione um tamanho
Alterar visualização
100 μL
R$ 4.140,00
About This Item
R$ 4.140,00
Check Cart for Availability
fonte biológica
rabbit
conjugado
unconjugated
forma do anticorpo
affinity isolated antibody
tipo de produto de anticorpo
primary antibodies
clone
polyclonal
linha de produto
Prestige Antibodies® Powered by Atlas Antibodies
Formulário
buffered aqueous glycerol solution
reatividade de espécies
human
técnica(s)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200
sequência de imunogênio
SPLHCSHPLGSLALGQSPGVSMMSPVPGCPPSPAYYSPATYHPLHSNLQAHLGQLSPPPEHPGFDALDQLSQVELLGDMDRNEFDQYLNTPGHPDSATGAMALSGHVPVSQVTPTGPTETSLISVLADATATYYNSYS
nº de adesão UniProt
Condições de expedição
wet ice
temperatura de armazenamento
−20°C
modificação pós-traducional do alvo
unmodified
Informações sobre genes
human ... SOX7(83595)
Descrição geral
SOX7 (Sex-determining region Y-box 7) is a transcription factor, which is a member of the SOX family. It belongs to the SOX F subgroup, which also contains SOX17 and SOX18. This gene is localized to human chromosome 8p23.1.
Imunogênio
Transcription factor SOX-7 recombinant protein epitope signature tag (PrEST)
Aplicação
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)
Western Blotting (1 paper)
Ações bioquímicas/fisiológicas
SOX7 (Sex-determining region Y-box 7) is involved in multiple developmental events such as, hematopoiesis, endoderm differentiation, vasculogenesis, cardiogenesis and myogenesis. This gene is deleted in non-small cell lung cancer (NSCLC), and functions as a tumor suppressor in colorectal and prostate cancer. Only Sox7 is capable of transcriptionally elevating the expression of SOX4. However, this results in suppression of Sox4-meditated activation of β-catenin/TCF (transcription factor) 4-driven transcription. SOX7 also functions in a complex feedback loop where activation of SOX4 results in the inhibition of its own promoter activity. It functions as tumor suppressor through Wnt/β-catenin pathway, and inactivation in ovarian cancer leads to malignancy and tumor suppression. It suppresses hepatocarcinogenesis, and thus, might have potential as a therapeutic target.[1]
Características e benefícios
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Ligação
Corresponding Antigen APREST70981
forma física
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Informações legais
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Exoneração de responsabilidade
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Não está encontrando o produto certo?
Experimente o nosso Ferramenta de seleção de produtos.
Código de classe de armazenamento
10 - Combustible liquids
Classe de risco de água (WGK)
WGK 1
Ponto de fulgor (°F)
Not applicable
Ponto de fulgor (°C)
Not applicable
Equipamento de proteção individual
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Escolha uma das versões mais recentes:
Certificados de análise (COA)
Lot/Batch Number
Não está vendo a versão correta?
Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.
Já possui este produto?
Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.
Takahide Hayano et al.
Journal of experimental & clinical cancer research : CR, 32, 17-17 (2013-04-06)
SOX7 is a transcription factor belonging to the SOX family. Its role in lung cancer is unknown. In this study, whole genomic copy number analysis was performed on a series of non-small cell lung cancer (NSCLC) cell lines and samples
Huidi Liu et al.
Journal of ovarian research, 7, 87-87 (2014-10-10)
Products of the SOX gene family play important roles in the life process. One of the members, SOX7, is associated with the development of a variety of cancers as a tumor suppression factor, but its relevance with ovarian cancer was
Lu Wang et al.
FASEB journal : official publication of the Federation of American Societies for Experimental Biology, 33(1), 254-263 (2018-06-30)
SOX7 (SRY-related high mobility group box 7), a high mobility group protein, is reported to be down-regulated in several cancer types, which indicates an important role in tumorigenesis; however, its biologic role in renal cell carcinoma (RCC) pathogenesis remains unknown.
Makoto Saegusa et al.
Laboratory investigation; a journal of technical methods and pathology, 92(4), 511-521 (2012-01-11)
Sox factors function as either activators or repressors of β-catenin/TCF transcription depending on the cellular context and associated interacting proteins. Our previous study provided evidence that alteration in β-catenin signaling is an essential event during transdifferentiation toward the morular phenotype
Xuechao Jiang et al.
Clinical science (London, England : 1979), 135(6), 829-846 (2021-03-16)
The endothelial-to-mesenchymal transition (EndMT) is a critical process that occurs during the development of the outflow tract (OFT). Malformations of the OFT can lead to the occurrence of conotruncal defect (CTD). SOX7 duplication has been reported in patients with congenital
Active Filters
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
Entre em contato com a assistência técnica
