Pular para o conteúdo
Merck
Todas as fotos(6)

Documentos Principais

HPA001562

Sigma-Aldrich

Anti-ATF3 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinônimo(s):

ATF3 Antibody - Anti-ATF3 antibody produced in rabbit, Atf3 Antibody, Anti-Activating transcription factor 3 antibody produced in rabbit, Anti-Cyclic AMP-dependent transcription factor ATF-3 antibody produced in rabbit

Faça loginpara ver os preços organizacionais e de contrato

Selecione um tamanho

100 μL
R$ 4.140,00

R$ 4.140,00


Check Cart for Availability


Selecione um tamanho

Alterar visualização
100 μL
R$ 4.140,00

About This Item

Número MDL:
Código UNSPSC:
12352203
Número do Atlas de Proteínas Humanas:
NACRES:
NA.43

R$ 4.140,00


Check Cart for Availability

fonte biológica

rabbit

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

linha de produto

Prestige Antibodies® Powered by Atlas Antibodies

Formulário

buffered aqueous glycerol solution

reatividade de espécies

human

validação aprimorada

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

técnica(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

sequência de imunogênio

MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTEC

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... ATF3(467)

Descrição geral

Activating transcription factor 3 (ATF3) gene is mapped to human chromosome 1q32.3. The encoded protein belongs to the cAMP-response element binding (CREB) protein family.
Rabbit polyclonal anti-ATF3 antibody reacts with human activating transcription factor 3.

Imunogênio

Cyclic AMP-dependent transcription factor ATF-3 recombinant protein epitope signature tag (PrEST)

Aplicação

Anti-ATF3 antibody produced in rabbit has been used in:
  • western blotting
  • immunofluorescence
  • immunohistochemical staining
  • chromatin immunoprecipitation (ChIP)

Ações bioquímicas/fisiológicas

Activating transcription factor 3 (ATF3), a cyclic AMP-dependent transcription factor stimulates transcription by sequestering inhibitory cofactors. ATF3 responds to stress signals and is involved in the regulation of immune and metabolic homeostasis. It helps to prevent chronic inflammation and starvation responses. ATF3 expression is induced in response to eye injury. It serves as a marker for neuronal injury.

Características e benefícios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST77475

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 1

Equipamento de proteção individual

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Saisai Wei et al.
The Journal of biological chemistry, 289(13), 8947-8959 (2014-02-21)
Mutant p53 proteins (mutp53) often acquire oncogenic activities, conferring drug resistance and/or promoting cancer cell migration and invasion. Although it has been well established that such a gain of function is mainly achieved through interaction with transcriptional regulators, thereby modulating
Inducible ATF3-NFAT axis aggravates podocyte injury
Zhang H, et al.
Journal of Molecular Medicine, 96(1), 53-64 (2018)
Activating transcription factor 3 (ATF3) expression in the neural retina and optic nerve of zebrafish during optic nerve regeneration
Saul KE, et al.
Comparative Biochemistry and Physiology. Part A, Molecular & Integrative Physiology, 155(2), 172-182 (2010)
Makoto Edagawa et al.
The Journal of biological chemistry, 289(31), 21544-21561 (2014-06-19)
Death receptor 5 (DR5) is a death domain-containing transmembrane receptor that triggers cell death upon binding to its ligand, TNF-related apoptosis-inducing ligand (TRAIL), and a combination of TRAIL and agents that increase the expression of DR5 is expected to be
Activating transcription factor 3 attenuates chemokine and cytokine expression in mouse skeletal muscle after exercise and facilitates molecular adaptation to endurance training
Fernandez VR, et al.
Faseb Journal, 31(2), 840-851 (2016)

Questions

Reviews

No rating value

Active Filters

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica