Pular para o conteúdo
Merck
Todas as fotos(1)

Documentos Principais

AV54586

Sigma-Aldrich

Anti-ACADSB antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-2-MEBCAD, Anti-ACAD7, Anti-Acyl-coenzyme A dehydrogenase, short/branched chain, Anti-SBCAD

Faça loginpara ver os preços organizacionais e de contrato

Selecione um tamanho

100 μL
R$ 3.345,00

R$ 3.345,00


Previsão de entrega em21 de maio de 2025



Selecione um tamanho

Alterar visualização
100 μL
R$ 3.345,00

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

R$ 3.345,00


Previsão de entrega em21 de maio de 2025


fonte biológica

rabbit

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

peso molecular

44 kDa

reatividade de espécies

human, rat, mouse, bovine

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão NCBI

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... ACADSB(36)

Imunogênio

Synthetic peptide directed towards the middle region of human ACADSB

Aplicação

Anti-ACADSB antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Ações bioquímicas/fisiológicas

The protein encoded by ACADSB (Acyl-coenzyme A dehydrogenase, short/branched chain) gene belongs to acyl-CoA dehydrogenases (ACADs) family and is mapped on to chromosome 10 at 10q25-q26. It is a homotetramer with each monomer comprising of a non-covalently bound flavin adenine dinucleotide (FAD) molecule as a cofactor. It catalyzes the initial step of mitochondrial fatty acid β-oxidation for substrates with four and six carbons. ACADSB also catalyzes the third step of leucine and isoleucine/valine metabolism. Deficiency of the encoded protein increases 2-methylbutyrylglycine and 2-methylbutyrylcarnitine in blood and urine and results in catabolism of L-isoleucine.

Sequência

Synthetic peptide located within the following region: GLRASSTCPLTFENVKVPEANILGQIGHGYKYAIGSLNEGRIGIAAQMLG

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

B Binzak et al.
Biochimica et biophysica acta, 1382(1), 137-142 (1998-03-21)
The acyl-CoA dehydrogenases (ACDs) are a family of related enzymes which catalyze the alpha,beta-dehydrogenation of acyl-CoA esters, transferring electrons to electron transferring flavoprotein. We have recently cloned and characterized the cDNA for human short/branched chain acyl-CoA dehydrogenase (SBCAD). Based on
K M Gibson et al.
Pediatric research, 47(6), 830-833 (2000-06-01)
An 4-mo-old male was found to have an isolated increase in 2-methylbutyrylglycine (2-MBG) and 2-methylbutyrylcamitine (2-MBC) in physiologic fluids. In vitro oxidation studies in cultured fibroblasts using 13C- and 14C-labeled branched chain amino acids indicated an isolated block in 2-methylbutyryl-CoA
Amy K Saenger et al.
Biochemistry, 44(49), 16043-16053 (2005-12-08)
Human short-chain acyl-CoA dehydrogenase (hSCAD) catalyzes the first matrix step in the mitochondrial beta-oxidation cycle for substrates with four and six carbons. Previous studies have shown that the act of substrate/product binding induces a large enzyme potential shift in acyl-CoA
P Deloukas et al.
Nature, 429(6990), 375-381 (2004-05-28)
The finished sequence of human chromosome 10 comprises a total of 131,666,441 base pairs. It represents 99.4% of the euchromatic DNA and includes one megabase of heterochromatic sequence within the pericentromeric region of the short and long arm of the

Questions

Reviews

No rating value

Active Filters

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica