Pular para o conteúdo
Merck
Todas as fotos(1)

Documentos Principais

AV54313

Sigma-Aldrich

Anti-AMT antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-Aminomethyltransferase, Anti-GCE, Anti-GCST, Anti-NKH

Faça loginpara ver os preços organizacionais e de contrato

Selecione um tamanho

100 μL
R$ 3.345,00

R$ 3.345,00

Previsão de entrega em22 de maio de 2025

Todas as fotos(1)

Selecione um tamanho

Alterar visualização
100 μL
R$ 3.345,00

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

R$ 3.345,00

Previsão de entrega em22 de maio de 2025

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

peso molecular

44 kDa

reatividade de espécies

bovine, dog, rabbit, human, rat, horse, guinea pig, mouse

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão NCBI

NP_000472

nº de adesão UniProt

P48728

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... AMT(275)

Imunogênio

Synthetic peptide directed towards the N terminal region of human AMT

Aplicação

Anti-AMT antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Ações bioquímicas/fisiológicas

AMT gene encodes an enzyme aminomethyltransferase (T-protein), localized on to subband 3p21.2-p21.1, that is the critical component of the glycine cleavage system. T-protein facilitates the degradation of glycine to produce ammonia and 5,10-methylenetetrahydrofolate. Mutation in the AMT gene leads to typical or atypical nonketotic hyperglycinemia (NKH).

Sequência

Synthetic peptide located within the following region: QRAVSVVARLGFRLQAFPPALCRPLSCAQEVLRRTPLYDFHLAHGGKMVA

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number
QC22814

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Pesquise por COA

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Kazuko Okamura-Ikeda et al.
The Journal of biological chemistry, 285(24), 18684-18692 (2010-04-09)
Aminomethyltransferase, a component of the glycine cleavage system termed T-protein, reversibly catalyzes the degradation of the aminomethyl moiety of glycine attached to the lipoate cofactor of H-protein, resulting in the production of ammonia, 5,10-methylenetetrahydrofolate, and dihydrolipoate-bearing H-protein in the presence
K Nanao et al.
Human genetics, 93(6), 655-658 (1994-06-01)
We have investigated the molecular lesions of T-protein deficiency causing typical or atypical nonketotic hyperglycinemia (NKH) in two unrelated pedigrees. A patient with typical NKH was identified as being homozygous for a missense mutation in the T-protein gene, a G-to-A
K Nanao et al.
Genomics, 19(1), 27-30 (1994-01-01)
The gene for human aminomethyltransferase (AMT), also known as the T-protein of the glycine cleavage system, was isolated from a human placental cosmid library and examined by restriction mapping, polymerase chain reaction analysis, and DNA sequencing. The gene is about

Questions

Reviews

No rating value

Active Filters

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica