Pular para o conteúdo
Merck
Todas as fotos(1)

Documentos

AV54274

Sigma-Aldrich

Anti-ATG10 antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-APG10, Anti-APG10L, Anti-ATG10 autophagy related 10 homolog (S. cerevisiae), Anti-DKFZP586I0418, Anti-FLJ13954, Anti-Pp12616

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(1)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

forma

buffered aqueous solution

peso molecular

25 kDa

reatividade de espécies

mouse, rat, human

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão NCBI

NP_113670

nº de adesão UniProt

Q9H0Y0

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... ATG10(83734)

Categorias relacionadas

Descrição geral

ATG10 [autophagy related 10 homolog (S. cerevisiae)] or APG10 gene encodes a protein necessary for autophagy in yeast. Autophagy is a catabolic cellular event that includes cell death of superfluous or dysfunctional cellular components, cell differentiation and aging. It is also crucial for the maintenance of amino acid levels and protein synthesis under nitrogen starvation and is enhanced under certain conditions such as hormonal stimulation and drug treatments.

Imunogênio

Synthetic peptide directed towards the C terminal region of human ATG10

Aplicação

Anti-ATG10 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Ações bioquímicas/fisiológicas

Atg10 is an E2-like enzyme that facilitates the addition of ubiquitination modifications essential for autophagosome formation. It catalyzes the conjugation of ATG12 to ATG5, which is essential for proper localization of ATG8 to the preautophagosomal structure (PAS). Further, Atg10 also plays a role in modifying the soluble form of LC3 to the membrane-bound form during Atg12 conjugation.

Sequência

Synthetic peptide located within the following region: TPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYAKATSQDERNVP

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Miao-Qing Zhang et al.
Frontiers in immunology, 9, 2176-2176 (2018-10-16)
Autophagy-related 10 (ATG10) is essential for autophagy since it promotes ATG5-ATG12 complex formation. Our previous study found that there are two isoforms of the ATG10 protein, ATG10 (a longer one) and ATG10S, which have identical sequences except an absence of
[The nurse; cancerology and radiotherapy].
C Chenal et al.
Revue de l'infirmiere, 26(8), 686-695 (1976-10-01)
N Mizushima et al.
Nature, 395(6700), 395-398 (1998-10-06)
Autophagy is a process for the bulk degradation of proteins, in which cytoplasmic components of the cell are enclosed by double-membrane structures known as autophagosomes for delivery to lysosomes or vacuoles for degradation. This process is crucial for survival during
Takahiro Nemoto et al.
The Journal of biological chemistry, 278(41), 39517-39526 (2003-08-02)
Autophagy is a process for the bulk degradation of cytosolic compartments by lysosomes/vacuoles. The formation of autophagosomes involves a dynamic rearrangement of the membrane for which two ubiquitin-like modifications (the conjugation of Apg12p and the modification of a soluble form

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica