Pular para o conteúdo
Merck
Todas as fotos(3)

Key Documents

AV53716

Sigma-Aldrich

Anti-ISYNA1 antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-Myo-inositol 1-phosphate synthase A1

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(3)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

forma

buffered aqueous solution

peso molecular

61 kDa

reatividade de espécies

human

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão NCBI

NP_057452

nº de adesão UniProt

Q9NPH2

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... ISYNA1(51477)

Imunogênio

Synthetic peptide directed towards the N terminal region of human ISYNA1

Aplicação

Anti-ISYNA1 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Ações bioquímicas/fisiológicas

ISYNA1 (inositol-3-phosphate synthase 1) gene encodes a protein that belongs to myo-inositol 1-phosphate synthase family and is predominantly expressed in testis, ovary, heart, placenta and pancreas. It is a crucial enzyme in myo-inositol biosynthesis pathway that plays a pivotal role in catalyzing the rate-limiting conversion of glucose 6-phosphate to myoinositol 1-phosphate.

Sequência

Synthetic peptide located within the following region: LQEQLWPHMEALRPRPSVYIPEFIAANQSARADNLIPGSRAQQLEQIRRD

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Guimin Guan et al.
Archives of biochemistry and biophysics, 417(2), 251-259 (2003-08-28)
myo-Inositol 1-phosphate synthase (EC 5.5.1.4) (IPS) is a key enzyme in myo-inositol biosynthesis pathway. This study describes the molecular cloning of the full length human myo-inositol 1-phosphate synthase (hIPS) cDNA, tissue distribution of its mRNA and characterizes its gene expression
Shulin Ju et al.
The Journal of biological chemistry, 279(21), 21759-21765 (2004-03-17)
We have cloned, sequenced, and expressed a human cDNA encoding 1-d-myo-inositol-3-phosphate (MIP) synthase (hINO1). The encoded 62-kDa human enzyme converted d-glucose 6-phosphate to 1-d-myo-inositol 3-phosphate, the rate-limiting step for de novo inositol biosynthesis. Activity of the recombinant human MIP synthase
A Azimi et al.
British journal of cancer, 110(10), 2489-2495 (2014-04-12)
Disseminated cutaneous malignant melanoma (CMM) is commonly unresponsive to standard chemotherapies, and there are as yet no predictive markers of therapy response. In the present study we collected fresh-frozen pretreatment lymph-node metastasis samples (n=14) from melanoma patients with differential response

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica