AV50512

Anti-ING1 antibody produced in rabbit

IgG fraction of antiserum

• Sinônimo(s): Anti-Inhibitor of growth family, member 1, Anti-p24ING1c, Anti-p33, Anti-p33ING1, Anti-p33ING1b, Anti-p47, Anti-p47ING1a
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: IgG fraction of antiserum
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• Formulário: buffered aqueous solution
• peso molecular: 32 kDa
• reatividade de espécies: dog, human, guinea pig, bovine, rat, mouse
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): western blot: suitable
• nº de adesão NCBI: NP_005528
• nº de adesão UniProt: Q5T9H0
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• Informações sobre genes: human ... ING1(3621)

Descrição

Imunogênio

Synthetic peptide directed towards the C terminal region of human ING1

Aplicação

Anti-ING1 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml.

Ações bioquímicas/fisiológicas

Inhibitor of growth family, member 1 (ING1; p47; p33) is a nuclear protein with tumor suppressor activity. It interacts with p53, participates in p53-mediated signaling and regulates cell growth and apoptosis.[1][2] However, ING1 also acts independent of p53; translocates to mitochondria and induces apoptosis by altering mitochondrial membrane potential.[2]

Sequência

Synthetic peptide located within the following region: EKKAKTSKKKKRSKAKAEREASPADLPIDPNEPTYCLCNQVSYGEMIGCD

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable