Pular para o conteúdo
Merck
Todas as fotos(1)

Documentos

AV49937

Sigma-Aldrich

Anti-ADAM33 antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-ADAM metallopeptidase domain 33, Anti-DJ964F7.1, Anti-DKFZp434K0521, Anti-FLJ35308, Anti-FLJ36751, Anti-MGC149823, Anti-MGC71889

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

forma

buffered aqueous solution

peso molecular

62 kDa

reatividade de espécies

dog, rat, human, mouse, pig, horse

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão NCBI

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... ADAM33(80332)

Descrição geral

ADAM metallopeptidase domain 33 (ADAM33) is a member of the ADAM (a disintegrin and metalloprotease domain) family. ADAM33 is largely expressed in mesenchymal cells including airway fibroblasts, myofibroblasts, and smooth muscle cells.

Imunogênio

Synthetic peptide directed towards the middle region of human ADAM33

Aplicação

Anti-ADAM33 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/mL.

Ações bioquímicas/fisiológicas

The members of the ADAM (a disintegrin and metalloprotease domain) family are involved in cell-to-cell and cell-to-matrix interactions, neurogenesis and muscle development. The expression of ADAM33 has been linked to asthma and chronic obstructive pulmonary disease (characterised by chronic bronchitis and emphysema). ADAM33 is also associated with inflammation of the lungs which is activated against etiological viral agents.

Sequência

Synthetic peptide located within the following region: HDSAQLLTGRAFQGATVGLAPVEGMCRAESSGGVSTDHSELPIGAAATMA

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Deng-Chuan Zhou et al.
Molecular biology reports, 42(2), 409-422 (2014-10-05)
A series of observational studies have been made to investigate the association of the ADAM33 gene polymorphisms with the risk of COPD, but their results were conflicting. Therefore, we performed an updated meta-analysis to quantitatively summarize the associations of ADAM33
Shelby P Umland et al.
American journal of respiratory cell and molecular biology, 29(5), 571-582 (2003-06-05)
We examined transcript expression and post-transcriptional regulation of human ADAM33, a recently identified asthma gene. A detailed messenger RNA (mRNA) expression profile was obtained using Northern, reverse transcription polymerase chain reaction, and in situ hybridization analyses. ADAM33 mRNA was expressed
Emanuele Baurakiades et al.
Journal of clinical virology : the official publication of the Pan American Society for Clinical Virology, 61(4), 585-589 (2014-12-03)
ADAM28, ADAM33, IL-13, IL-4 and other cytokines (IL-6 and IL-10) seem to play important roles in the persistence and maintenance of acute inflammatory processes that ultimately lead to lung remodeling and pulmonary fibrosis, which may be responsible for the high
Feng Lin et al.
Molecular medicine reports, 8(4), 1209-1215 (2013-08-13)
A disintegrin and metalloproteinase 33 (ADAM33) has been identified as an asthma susceptibility gene; however, the role of ADAM33 in the pathogenesis and progression of asthma remains to be elucidated. As ADAM33 is predominantly expressed in airway smooth muscle cells
Paul Van Eerdewegh et al.
Nature, 418(6896), 426-430 (2002-07-12)
Asthma is a common respiratory disorder characterized by recurrent episodes of coughing, wheezing and breathlessness. Although environmental factors such as allergen exposure are risk factors in the development of asthma, both twin and family studies point to a strong genetic

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica