AV46856

Anti-CHIC2 antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-BTL, Anti-Cysteine-rich hydrophobic domain 2, Anti-MGC21173
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• forma: buffered aqueous solution
• peso molecular: 19 kDa
• reatividade de espécies: guinea pig, human, bovine, rat, dog, mouse, horse, rabbit
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): immunohistochemistry: suitable; western blot: suitable
• nº de adesão NCBI: NP_036242
• nº de adesão UniProt: Q9UKJ5
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• Informações sobre genes: human ... CHIC2(26511)

Descrição

Imunogênio

Synthetic peptide directed towards the N terminal region of human CHIC2

Aplicação

Anti-CHIC2 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/mL. It is also useful for immunohistochemistry at a concentration of 4-8μg/mL.

Ações bioquímicas/fisiológicas

CHIC2 (cysteine-rich hydrophobic domain 2) gene encodes for a 165 amino acid containing membrane protein that belongs to the CHIC family. CHIC2 is associated with vesicular structures and the plasma membrane, signifying that it may regulate exocytosis. CHIC2 gene is also involved in a chromosomal translocation occurring in acute myeloid leukemias.

Sequência

Synthetic peptide located within the following region: EEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASI

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable