AV46788

Anti-LMAN2 (AB1) antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-C5orf8, Anti-GP36B, Anti-Lectin, mannose-binding 2, Anti-VIP36
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• Formulário: buffered aqueous solution
• peso molecular: 36 kDa
• reatividade de espécies: human, bovine, rabbit, rat, mouse, dog, horse, guinea pig
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): immunohistochemistry: suitable; western blot: suitable
• nº de adesão NCBI: NP_006807
• nº de adesão UniProt: Q12907
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... LMAN2(10960)

Descrição

Descrição geral

Lectin, mannose-binding 2 (LMAN2, VIP36) is an intracellular, integral membrane protein that functions as a lectin of the post-Golgi secretory pathway. LMAN2 facilitates the secretion of high mannose glycoproteins predominantly via the apical surface of cells.

Especificidade

Anti-LMAN2 (AB1) polyclonal antibody reacts with zebrafish, bovine, human, rat, canine, and mouse lectin, mannose-binding 2 proteins.

Imunogênio

Synthetic peptide directed towards the N terminal region of human LMAN2

Aplicação

Anti-LMAN2 (AB1) polyclonal antibody is used to tag lectin, mannose-binding 2 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of lectin, mannose-binding 2 in the secretion of high mannose glycoproteins.

Ações bioquímicas/fisiológicas

LMAN2 plays a role as an intracellular lectin in the early secretory pathway. It interacts with N-acetyl-D-galactosamine and high-mannose type glycans and may also bind to O-linked glycans. It is involved in the transport and sorting of glycoproteins carrying high mannose-type glycans.

Sequência

Synthetic peptide located within the following region: SLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCF

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable