Pular para o conteúdo
Merck
Todas as fotos(2)

Documentos

AV46095

Sigma-Aldrich

Anti-ATIC (AB2) antibody produced in rabbit

IgG fraction of antiserum

Sinônimo(s):

Anti-5-Aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase, Anti-AICAR, Anti-AICARFT, Anti-IMPCHASE, Anti-PURH

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(2)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

IgG fraction of antiserum

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

forma

buffered aqueous solution

peso molecular

64 kDa

reatividade de espécies

yeast, guinea pig, mouse, human, rabbit, rat

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão NCBI

NP_004035

nº de adesão UniProt

P31939

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... ATIC(471)

Imunogênio

Synthetic peptide directed towards the N terminal region of human ATIC

Aplicação

Anti-ATIC (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml.

Ações bioquímicas/fisiológicas

ATIC gene encodes a bifunctional enzyme 5-Amino-4-imidazolecarboxamide ribonucleotide transformylase/IMP cyclohydrolase. The enzyme is responsible for catalysis of the last two steps in the de novo synthesis of inosine 5′-monophosphate. The N-terminal domain comprise of phosphoribosylaminoimidazolecarboxamide formyltransferase activity whereas the C-terminal domain has IMP cyclohydrolase activity. Mutation in ATIC gene results in destabilization of various degrees of purinosome assembly which leads to AICA-ribosiduria.

Sequência

Synthetic peptide located within the following region: YVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKG

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Veronika Baresova et al.
Human molecular genetics, 21(7), 1534-1543 (2011-12-20)
The purinosome is a multienzyme complex composed by the enzymes active in de novo purine synthesis (DNPS) that cells transiently assemble in their cytosol upon depletion or increased demand of purines. The process of purinosome formation has thus far been
Karen G Bulock et al.
The Journal of biological chemistry, 277(25), 22168-22174 (2002-04-12)
5-Amino-4-imidazolecarboxamide ribonucleotide transformylase/IMP cyclohydrolase (ATIC) is a bifunctional protein possessing two enzymatic activities that sequentially catalyze the last two steps in the pathway for de novo synthesis of inosine 5'-monophosphate. This bifunctional enzyme is of particular interest because of its

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica